BLASTX nr result
ID: Glycyrrhiza35_contig00020639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020639 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019464868.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 GAU27603.1 hypothetical protein TSUD_271440 [Trifolium subterran... 57 5e-07 >XP_019464868.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Lupinus angustifolius] OIV99239.1 hypothetical protein TanjilG_06544 [Lupinus angustifolius] Length = 502 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -1 Query: 405 YVHGEITETNVLNLMKGDYHLKTDEVPHGEKQHEMCFQGEGQLL 274 YV GEI ET +LMK DY+LK DEVP GEKQHEM QG GQ L Sbjct: 458 YVRGEIPETKAFDLMKEDYYLKADEVPDGEKQHEM-LQGRGQQL 500 >GAU27603.1 hypothetical protein TSUD_271440 [Trifolium subterraneum] Length = 493 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 405 YVHGEITETNVLNLMKGDYHLKTDEVPHGEKQHEM 301 YV GEI+ETN L LMKGDYHL+ DEV GEKQ+EM Sbjct: 459 YVQGEISETNALKLMKGDYHLRNDEVLDGEKQNEM 493