BLASTX nr result
ID: Glycyrrhiza35_contig00020481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020481 (689 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM31307.1 hypothetical protein LR48_Vigan01g086200 [Vigna angul... 56 4e-06 >KOM31307.1 hypothetical protein LR48_Vigan01g086200 [Vigna angularis] Length = 207 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 7/49 (14%) Frame = +3 Query: 561 EPVRSRSLSVP-------LRTGDHSSASGCHMPTSFRLVRPRTILYWER 686 E RSRSL+VP R SS GCHMPTSFRLVRPRT YWER Sbjct: 13 EAARSRSLTVPPAPCFLHRRHSPPSSVPGCHMPTSFRLVRPRTTPYWER 61