BLASTX nr result
ID: Glycyrrhiza35_contig00020434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020434 (664 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRG96770.1 hypothetical protein GLYMA_19G231600 [Glycine max] 74 4e-13 XP_003626201.1 hypothetical protein MTR_7g112600 [Medicago trunc... 63 5e-09 BAT88118.1 hypothetical protein VIGAN_05156000 [Vigna angularis ... 60 4e-08 >KRG96770.1 hypothetical protein GLYMA_19G231600 [Glycine max] Length = 154 Score = 73.9 bits (180), Expect = 4e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -2 Query: 663 KNKEKERSKSHRHKRQKHSVKEVGHFFVPCFIVFHWLVYEIVWYSSSLKLLTPV 502 KNKEK++SKSHRHK QKH VKEVGHFF+P F++ +++IVWYSS LK LT V Sbjct: 98 KNKEKDQSKSHRHKWQKHKVKEVGHFFMP-FLLSSIGLFKIVWYSSYLKFLTQV 150 >XP_003626201.1 hypothetical protein MTR_7g112600 [Medicago truncatula] AES82419.1 hypothetical protein MTR_7g112600 [Medicago truncatula] Length = 146 Score = 62.8 bits (151), Expect = 5e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 663 KNKEKERSKSHRHKRQKHSVKEVGHFFVPCFIVFHWLVYEIVWYSSSLKLLT 508 KNKEKERSKSHRHKR KHS+KEVGHFF +I +H ++++ + K+LT Sbjct: 97 KNKEKERSKSHRHKRHKHSLKEVGHFF--SYIAYHTGLFKLFVFFVLFKVLT 146 >BAT88118.1 hypothetical protein VIGAN_05156000 [Vigna angularis var. angularis] Length = 143 Score = 60.5 bits (145), Expect = 4e-08 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = -2 Query: 663 KNKEKERSKSHRHKRQKHSVKEVGHFFVPCFIVFHWLVYEIVWYSSSLK 517 KNKEK+RSKSH HKRQKH VKEVGHFF+ + Y V +SS LK Sbjct: 100 KNKEKDRSKSHHHKRQKHKVKEVGHFFILLYF------YSCVLFSSYLK 142