BLASTX nr result
ID: Glycyrrhiza35_contig00020264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020264 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001238290.1 uncharacterized protein LOC100500450 [Glycine max... 52 9e-06 >NP_001238290.1 uncharacterized protein LOC100500450 [Glycine max] ACU15537.1 unknown [Glycine max] Length = 111 Score = 51.6 bits (122), Expect = 9e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -2 Query: 129 NHVWPVQPTSLSSMIP*AFFLTGIRLVQGVVIQKLLNEVNMGH 1 + W S SS+IP AFFL IRLVQ +VI++LLNE+N+GH Sbjct: 4 HRAWNTTEASWSSVIPQAFFLIEIRLVQSIVIEQLLNEINVGH 46