BLASTX nr result
ID: Glycyrrhiza35_contig00020096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020096 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23748.1 hypothetical protein TSUD_128520 [Trifolium subterran... 83 1e-16 XP_013459985.1 cytochrome P450 family 71 protein [Medicago trunc... 81 4e-16 XP_013452465.1 cytochrome P450 family 71 protein [Medicago trunc... 80 7e-16 XP_013459986.1 cytochrome P450 family 71 protein [Medicago trunc... 80 1e-15 GAU23746.1 hypothetical protein TSUD_128500 [Trifolium subterran... 79 3e-15 XP_013441759.1 cytochrome P450 family 71 protein [Medicago trunc... 78 5e-15 GAU23745.1 hypothetical protein TSUD_128490 [Trifolium subterran... 78 6e-15 XP_013459983.1 cytochrome P450 family 71 protein [Medicago trunc... 77 2e-14 KHM99473.1 Cytochrome P450 71D11 [Glycine soja] 76 2e-14 GAU23747.1 hypothetical protein TSUD_128510 [Trifolium subterran... 76 2e-14 XP_003530791.1 PREDICTED: cytochrome P450 71D9-like [Glycine max... 76 2e-14 XP_013459992.1 cytochrome P450 family 71 protein [Medicago trunc... 75 7e-14 XP_013459982.1 cytochrome P450 family 71 protein [Medicago trunc... 75 8e-14 GAU23749.1 hypothetical protein TSUD_128530 [Trifolium subterran... 74 1e-13 XP_004506715.1 PREDICTED: cytochrome P450 71D9-like isoform X1 [... 74 1e-13 XP_013459994.1 cytochrome P450 family 71 protein [Medicago trunc... 74 1e-13 XP_007146291.1 hypothetical protein PHAVU_006G028100g [Phaseolus... 74 2e-13 KOM52349.1 hypothetical protein LR48_Vigan09g100800 [Vigna angul... 73 3e-13 XP_017435580.1 PREDICTED: cytochrome P450 71D11-like [Vigna angu... 73 3e-13 BAT88722.1 hypothetical protein VIGAN_05230700 [Vigna angularis ... 73 4e-13 >GAU23748.1 hypothetical protein TSUD_128520 [Trifolium subterraneum] Length = 473 Score = 82.8 bits (203), Expect = 1e-16 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLP 132 LYHFDWKLPSG+RSEELDMTEEFGVTMRRKDDLLL YH LP Sbjct: 430 LYHFDWKLPSGIRSEELDMTEEFGVTMRRKDDLLLLPFFYHPLP 473 >XP_013459985.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34016.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 473 Score = 81.3 bits (199), Expect = 4e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPVI 138 LYHFDWKLPSG++SEELDMT+EFG TMRRKD+LLLF+ YH L VI Sbjct: 428 LYHFDWKLPSGIKSEELDMTDEFGATMRRKDELLLFSSVYHPLHVI 473 >XP_013452465.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH26493.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 509 Score = 80.5 bits (197), Expect = 7e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPVI 138 LYHFDWKLPSG++SEELDMTEEFGVTM+RK+DLL+ +YH PVI Sbjct: 462 LYHFDWKLPSGIKSEELDMTEEFGVTMKRKNDLLVLPLSYHPFPVI 507 >XP_013459986.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34017.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 504 Score = 80.1 bits (196), Expect = 1e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSL 129 LYHFDWKLPSG+RSE+LDMT+EFG TMRRKDDLLLF+ YH L Sbjct: 462 LYHFDWKLPSGIRSEDLDMTDEFGATMRRKDDLLLFSFVYHPL 504 >GAU23746.1 hypothetical protein TSUD_128500 [Trifolium subterraneum] Length = 437 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLPSG++S+ELDMTEEFGVT+RRKD+LLLF YH L V Sbjct: 392 LYHFDWKLPSGIKSDELDMTEEFGVTVRRKDNLLLFPSVYHPLHV 436 >XP_013441759.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH15784.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 508 Score = 78.2 bits (191), Expect = 5e-15 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSL 129 LYHFDWKLP G++SEELDMTEEFGVTMRRKDDL LF YH L Sbjct: 463 LYHFDWKLPCGIKSEELDMTEEFGVTMRRKDDLSLFPSVYHPL 505 >GAU23745.1 hypothetical protein TSUD_128490 [Trifolium subterraneum] Length = 437 Score = 77.8 bits (190), Expect = 6e-15 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPVI 138 LYHFDWKLP+G+RSEELDMT+EFGVTMRRKDDLL+ +YH V+ Sbjct: 392 LYHFDWKLPTGIRSEELDMTDEFGVTMRRKDDLLVLPFSYHPFSVM 437 >XP_013459983.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34014.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 507 Score = 76.6 bits (187), Expect = 2e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLP+G++SEELDMTE+FG+T+ RKDDLLL YH LPV Sbjct: 462 LYHFDWKLPNGIKSEELDMTEKFGITVCRKDDLLLLPSVYHHLPV 506 >KHM99473.1 Cytochrome P450 71D11 [Glycine soja] Length = 473 Score = 76.3 bits (186), Expect = 2e-14 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDW LP+GMRS ELDM+EEFGVT+RRKDDL+L YH LPV Sbjct: 428 LYHFDWNLPNGMRSGELDMSEEFGVTVRRKDDLILVPFPYHPLPV 472 >GAU23747.1 hypothetical protein TSUD_128510 [Trifolium subterraneum] Length = 508 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLPSG+RSEELDMTEEFGVT+RRKD+LLL +H L V Sbjct: 463 LYHFDWKLPSGIRSEELDMTEEFGVTVRRKDNLLLVPSIFHPLHV 507 >XP_003530791.1 PREDICTED: cytochrome P450 71D9-like [Glycine max] KRH46341.1 hypothetical protein GLYMA_08G327200 [Glycine max] Length = 510 Score = 76.3 bits (186), Expect = 2e-14 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDW LP+GMRS ELDM+EEFGVT+RRKDDL+L YH LPV Sbjct: 465 LYHFDWNLPNGMRSGELDMSEEFGVTVRRKDDLILVPFPYHPLPV 509 >XP_013459992.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34023.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 427 Score = 74.7 bits (182), Expect = 7e-14 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPVI 138 L++FDWKLPSG+RSEELDMTEEFGV +RRKDDLLL H LPV+ Sbjct: 382 LFYFDWKLPSGIRSEELDMTEEFGVAVRRKDDLLLLPFVCHPLPVM 427 >XP_013459982.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34013.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 509 Score = 74.7 bits (182), Expect = 8e-14 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLP G++ +ELDMTE+FGVTMRRKDDLLL YH L V Sbjct: 464 LYHFDWKLPGGIKCDELDMTEQFGVTMRRKDDLLLLPFVYHPLNV 508 >GAU23749.1 hypothetical protein TSUD_128530 [Trifolium subterraneum] Length = 943 Score = 74.3 bits (181), Expect = 1e-13 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLP+G+RSEELDMT+EFG+++RRKD LL+F YH L V Sbjct: 898 LYHFDWKLPTGIRSEELDMTDEFGISVRRKDHLLVFPFVYHPLHV 942 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLL 105 LYHFDWKLPSG+RSEELDMTEEFGVT+RRKDDLLL Sbjct: 390 LYHFDWKLPSGIRSEELDMTEEFGVTLRRKDDLLL 424 >XP_004506715.1 PREDICTED: cytochrome P450 71D9-like isoform X1 [Cicer arietinum] Length = 507 Score = 73.9 bits (180), Expect = 1e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLP G+ SEE+DMTEEFGVT+RRKDDLLL AY+ L V Sbjct: 462 LYHFDWKLPCGITSEEMDMTEEFGVTVRRKDDLLLLPFAYNPLHV 506 >XP_013459994.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH34025.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 508 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLPSG+ EE+DMTEEFG+T+RRKDDLLL YH L V Sbjct: 463 LYHFDWKLPSGITGEEMDMTEEFGLTVRRKDDLLLCPFVYHPLQV 507 >XP_007146291.1 hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris] ESW18285.1 hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris] Length = 507 Score = 73.6 bits (179), Expect = 2e-13 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDWKLPSGMRSEEL+M+E FGVTM+RK DL L YH LPV Sbjct: 462 LYHFDWKLPSGMRSEELNMSEVFGVTMKRKYDLFLVPFPYHPLPV 506 >KOM52349.1 hypothetical protein LR48_Vigan09g100800 [Vigna angularis] Length = 435 Score = 73.2 bits (178), Expect = 3e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDW+LP GM SEELDM+E+FGVT+RRK DLLLFA Y LPV Sbjct: 390 LYHFDWRLPCGMISEELDMSEDFGVTVRRKHDLLLFAFPYLPLPV 434 >XP_017435580.1 PREDICTED: cytochrome P450 71D11-like [Vigna angularis] BAT88525.1 hypothetical protein VIGAN_05204300 [Vigna angularis var. angularis] Length = 508 Score = 73.2 bits (178), Expect = 3e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPV 135 LYHFDW+LP GM SEELDM+E+FGVT+RRK DLLLFA Y LPV Sbjct: 463 LYHFDWRLPCGMISEELDMSEDFGVTVRRKHDLLLFAFPYLPLPV 507 >BAT88722.1 hypothetical protein VIGAN_05230700 [Vigna angularis var. angularis] Length = 471 Score = 72.8 bits (177), Expect = 4e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +1 Query: 1 LYHFDWKLPSGMRSEELDMTEEFGVTMRRKDDLLLFACAYHSLPVI 138 LYHFDWKLPSG+ SEEL+M+E FG+TMRRKD+L L YH LPVI Sbjct: 426 LYHFDWKLPSGITSEELNMSEVFGLTMRRKDELYLVPFPYHPLPVI 471