BLASTX nr result
ID: Glycyrrhiza35_contig00020005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020005 (782 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010055353.1 PREDICTED: type I inositol polyphosphate 5-phosph... 77 2e-12 KJB51689.1 hypothetical protein B456_008G228600 [Gossypium raimo... 77 2e-12 XP_012439367.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-... 77 3e-12 KJB51693.1 hypothetical protein B456_008G228600 [Gossypium raimo... 77 3e-12 XP_016736653.1 PREDICTED: type I inositol polyphosphate 5-phosph... 77 3e-12 XP_012439365.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-... 77 3e-12 XP_017635113.1 PREDICTED: type I inositol polyphosphate 5-phosph... 77 3e-12 KHF98952.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -... 77 3e-12 XP_007155751.1 hypothetical protein PHAVU_003G228700g [Phaseolus... 76 4e-12 XP_014631958.1 PREDICTED: type I inositol polyphosphate 5-phosph... 75 4e-12 XP_017412115.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_017412114.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_014509747.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_017412113.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_017412112.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_017412111.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_014509746.1 PREDICTED: type I inositol polyphosphate 5-phosph... 76 5e-12 XP_007155752.1 hypothetical protein PHAVU_003G228700g [Phaseolus... 76 5e-12 XP_016557094.1 PREDICTED: type I inositol polyphosphate 5-phosph... 72 5e-12 KHG24158.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -... 75 7e-12 >XP_010055353.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2 [Eucalyptus grandis] KCW71820.1 hypothetical protein EUGRSUZ_E00306 [Eucalyptus grandis] Length = 630 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MKA+RG+RSEAFWPSIMMKKWLNIK + YDFSEDEVDTE Sbjct: 1 MKARRGKRSEAFWPSIMMKKWLNIKPQVYDFSEDEVDTE 39 >KJB51689.1 hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 474 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_012439367.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X2 [Gossypium raimondii] KJB51692.1 hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 511 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >KJB51693.1 hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 516 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_016736653.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Gossypium hirsutum] XP_016736654.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Gossypium hirsutum] Length = 630 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_012439365.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] KJB51688.1 hypothetical protein B456_008G228600 [Gossypium raimondii] KJB51690.1 hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 630 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_017635113.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Gossypium arboreum] Length = 640 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >KHF98952.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -like protein [Gossypium arboreum] KHG00504.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -like protein [Gossypium arboreum] Length = 648 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_007155751.1 hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] ESW27745.1 hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] Length = 466 Score = 75.9 bits (185), Expect = 4e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_014631958.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Glycine max] Length = 324 Score = 75.1 bits (183), Expect = 4e-12 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 146 SYSIF*PEAMKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 ++ I+ + MKA+RG+RSEAFWPSI+MKKWLNIK K DFSEDEVDTE Sbjct: 54 NFCIWTHQTMKARRGKRSEAFWPSIVMKKWLNIKPKVNDFSEDEVDTE 101 >XP_017412115.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X5 [Vigna angularis] Length = 509 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_017412114.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X4 [Vigna angularis] Length = 511 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_014509747.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X2 [Vigna radiata var. radiata] Length = 536 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_017412113.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X3 [Vigna angularis] KOM32484.1 hypothetical protein LR48_Vigan01g204000 [Vigna angularis] Length = 579 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_017412112.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X2 [Vigna angularis] Length = 583 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_017412111.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X1 [Vigna angularis] BAT75754.1 hypothetical protein VIGAN_01366800 [Vigna angularis var. angularis] Length = 607 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_014509746.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X1 [Vigna radiata var. radiata] Length = 622 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_007155752.1 hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] ESW27746.1 hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] Length = 622 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RGRRSEAFWPS++MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTE 39 >XP_016557094.1 PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Capsicum annuum] Length = 160 Score = 72.0 bits (175), Expect = 5e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RG+RS+AFWPSI+MKKWLNI K YDFSEDEVDTE Sbjct: 3 MKTRRGKRSQAFWPSIVMKKWLNIAPKVYDFSEDEVDTE 41 >KHG24158.1 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -like protein [Gossypium arboreum] Length = 611 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTE 3 MK +RG+RSEAFWPSI+MKKWLNIK K YDFSEDEVDTE Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39