BLASTX nr result
ID: Glycyrrhiza35_contig00019847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019847 (520 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] N... 114 2e-30 OMP13262.1 hypothetical protein COLO4_01988 [Corchorus olitorius] 91 4e-21 OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] 77 3e-14 OAY56484.1 hypothetical protein MANES_02G020200, partial [Maniho... 66 1e-11 XP_006435528.1 hypothetical protein CICLE_v10010881mg [Citrus cl... 60 3e-10 KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] 66 2e-09 KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp... 59 6e-09 KVH98711.1 Maturase MatK, N-terminal domain-containing protein, ... 62 3e-08 KZV38793.1 hypothetical protein F511_19843 [Dorcoceras hygrometr... 52 3e-06 >NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] NP_054565.1 hypothetical protein NitaCp091 [Nicotiana tabacum] YP_358732.1 hypothetical protein NisyCp089 [Nicotiana sylvestris] YP_358746.1 hypothetical protein NisyCp103 [Nicotiana sylvestris] YP_398918.1 hypothetical protein NitoCp088 [Nicotiana tomentosiformis] YP_398932.1 hypothetical protein NitoCp102 [Nicotiana tomentosiformis] YP_004891661.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891675.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA26288.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77393.1 hypothetical protein (chloroplast) [Nicotiana tabacum] AAA84690.1 unknown (chloroplast) [Nicotiana tabacum] CAA77400.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46709.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46723.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48058.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48072.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95619.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95646.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95728.1 hypothetical protein [synthetic construct] AEO95754.1 hypothetical protein [synthetic construct] AMM05595.1 hypothetical protein (plastid) [Nicotiana tabacum] prf||1211235CK ORF 75 Length = 75 Score = 114 bits (286), Expect = 2e-30 Identities = 62/76 (81%), Positives = 69/76 (90%) Frame = +2 Query: 119 MRHGTEPLRRSSTSYKKGNFELILMMG*EQE*NSMRSNLPVFLSSSVVERSAVNRLVVGS 298 MRH EPLRRSS SY+ G+FELIL+MG E+E NSMRSNL +FLSSSVVERSAVNRLVVGS Sbjct: 1 MRHVREPLRRSSGSYE-GSFELILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGS 59 Query: 299 SPTWGDLINSELKNSE 346 +PTWGDLI+SELKNSE Sbjct: 60 NPTWGDLIDSELKNSE 75 >OMP13262.1 hypothetical protein COLO4_01988 [Corchorus olitorius] Length = 82 Score = 91.3 bits (225), Expect = 4e-21 Identities = 50/70 (71%), Positives = 54/70 (77%) Frame = -1 Query: 469 IDGYSQISQNRMGYDEIQCNRNKDRGNELPTLT*WSKQTVSFRIL*FGINQISPSRT*TY 290 IDG SQISQNRMGYDEI+CNRNKD GN LP L S+ S IL +G+NQIS SR TY Sbjct: 13 IDGDSQISQNRMGYDEIECNRNKDTGNGLPALNGQSEPFHS-DILEYGMNQISSSRIRTY 71 Query: 289 DQSVNSRPLY 260 DQSVNSRPLY Sbjct: 72 DQSVNSRPLY 81 >OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] Length = 193 Score = 76.6 bits (187), Expect = 3e-14 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -2 Query: 333 NSELIKSPQVGLEPTTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 169 N+ L++ Q G EPTT++LTADRSTTELLRN G+ DLIEF S SQP+ NM+SKFP Sbjct: 116 NTALVEFSQDGFEPTTSQLTADRSTTELLRNNGRLDLIEFNSRSQPMTNMNSKFP 170 >OAY56484.1 hypothetical protein MANES_02G020200, partial [Manihot esculenta] Length = 42 Score = 65.9 bits (159), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 291 TTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 169 TT++LTADRSTTELLRN G+ DLIEF S SQP+ NMSSKFP Sbjct: 1 TTSQLTADRSTTELLRNNGRLDLIEFNSRSQPMTNMSSKFP 41 >XP_006435528.1 hypothetical protein CICLE_v10010881mg [Citrus clementina] ESR48768.1 hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 59.7 bits (143), Expect(3) = 3e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 469 IDGYSQISQNRMGYDEIQCNRNKDRGNELPT 377 IDG SQISQNRMGYDEI+CNRNKD GN LPT Sbjct: 53 IDGDSQISQNRMGYDEIECNRNKDTGNGLPT 83 Score = 27.3 bits (59), Expect(3) = 3e-10 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 369 NGQSKPFHSEFFNS 328 NGQS+PFHS+ NS Sbjct: 85 NGQSEPFHSDILNS 98 Score = 24.6 bits (52), Expect(3) = 3e-10 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 347 IPNSLIRN*SNLPK 306 I NSLIRN SNLPK Sbjct: 95 ILNSLIRNESNLPK 108 >KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] Length = 742 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 288 TNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 169 TN+LTADRSTTELLRN G+FDLIEF S SQP+ NMS KFP Sbjct: 702 TNQLTADRSTTELLRNNGRFDLIEFNSRSQPMTNMSLKFP 741 >KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp. vulgaris] Length = 42 Score = 58.9 bits (141), Expect = 6e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 288 TNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 169 TN+LT DRSTTELLRN + DLIEF S SQP+ NMSSK P Sbjct: 2 TNQLTTDRSTTELLRNNKRLDLIEFNSRSQPMTNMSSKLP 41 >KVH98711.1 Maturase MatK, N-terminal domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 276 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 324 LIKSPQVGLEPTTNRLTADRSTTELLRNTGKFD 226 + KSPQVG EPTTNRLTADRSTTELLRN G+FD Sbjct: 3 IFKSPQVGFEPTTNRLTADRSTTELLRNNGRFD 35 >KZV38793.1 hypothetical protein F511_19843 [Dorcoceras hygrometricum] KZV51010.1 hypothetical protein F511_18990 [Dorcoceras hygrometricum] Length = 56 Score = 52.0 bits (123), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 294 PTTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 169 PT N T DRSTTELLRN G+ DL+EF S SQP+ NMSS P Sbjct: 15 PTLNGQT-DRSTTELLRNNGRLDLLEFNSRSQPMTNMSSNPP 55