BLASTX nr result
ID: Glycyrrhiza35_contig00019643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019643 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterran... 54 1e-14 KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus c... 70 1e-11 >GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterraneum] Length = 291 Score = 54.3 bits (129), Expect(2) = 1e-14 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 263 LLCNFFLEGNLPACLLSFYPQICIFS 186 L NFFLEGNLPACLLSFYPQICIFS Sbjct: 53 LSANFFLEGNLPACLLSFYPQICIFS 78 Score = 52.8 bits (125), Expect(2) = 1e-14 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 337 ERVDMKSGTSTKGKYAELLSWFANLFSAIFF 245 ERVDMKSGT+TKGKYAELLSW ANL SA FF Sbjct: 29 ERVDMKSGTTTKGKYAELLSWLANL-SANFF 58 >KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus cajan] Length = 354 Score = 69.7 bits (169), Expect = 1e-11 Identities = 41/73 (56%), Positives = 48/73 (65%) Frame = -1 Query: 337 ERVDMKSGTSTKGKYAELLSWFANLFSAIFFWKETFLLVCSPSIHRSAFSHLMLIRHSLP 158 +RVDMKSG + G + L IFFWKETFLLVC PS +RSAFSHL +IRHSL Sbjct: 29 DRVDMKSGKTLGGNMLSKVLACQPL--PIFFWKETFLLVCPPSTYRSAFSHL-IIRHSLT 85 Query: 157 SSPNIDIFIPSEC 119 SS + +I I EC Sbjct: 86 SSSSPNIDISPEC 98