BLASTX nr result
ID: Glycyrrhiza35_contig00019509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019509 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP47362.1 Coleoptile phototropism protein 1 [Cajanus cajan] 67 5e-11 XP_014509369.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 67 7e-11 XP_007155836.1 hypothetical protein PHAVU_003G235700g [Phaseolus... 67 7e-11 XP_017406862.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 67 1e-10 XP_004511848.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 64 7e-10 XP_003611607.1 phototropic-responsive NPH3 family protein [Medic... 64 7e-10 XP_014631084.1 PREDICTED: BTB/POZ domain-containing protein NPY2... 64 9e-10 XP_014631083.1 PREDICTED: BTB/POZ domain-containing protein NPY2... 64 9e-10 XP_006579937.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 64 9e-10 XP_006579940.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 64 1e-09 KHN06014.1 BTB/POZ domain-containing protein NPY2 [Glycine soja] 64 1e-09 KHN23238.1 BTB/POZ domain-containing protein NPY2 [Glycine soja] 64 1e-09 XP_014625250.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 64 1e-09 XP_016185946.1 PREDICTED: BTB/POZ domain-containing protein NPY3... 63 2e-09 XP_015957107.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 63 2e-09 XP_015963833.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 62 3e-09 XP_016201639.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 62 3e-09 GAU26116.1 hypothetical protein TSUD_225790 [Trifolium subterran... 61 8e-09 XP_019421019.1 PREDICTED: BTB/POZ domain-containing protein NPY4... 60 1e-08 XP_014625249.1 PREDICTED: BTB/POZ domain-containing protein NPY2... 59 7e-08 >KYP47362.1 Coleoptile phototropism protein 1 [Cajanus cajan] Length = 508 Score = 67.4 bits (163), Expect = 5e-11 Identities = 39/62 (62%), Positives = 43/62 (69%) Frame = +1 Query: 100 HVAKKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHS 279 + A KMK L ++ S SGELT+SDTSESPASTVVEETKSTPSRSRRHS Sbjct: 451 NTASKMKGLMSKKILSKIWSSK----EKSGELTSSDTSESPASTVVEETKSTPSRSRRHS 506 Query: 280 VS 285 VS Sbjct: 507 VS 508 >XP_014509369.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna radiata var. radiata] XP_014509370.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna radiata var. radiata] XP_014509371.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna radiata var. radiata] Length = 607 Score = 67.0 bits (162), Expect = 7e-11 Identities = 42/62 (67%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = +1 Query: 106 AKKMKH--QEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHS 279 A KMK +K M +W SS SGELT+SDTSESPASTVVEETKSTPSRSRRHS Sbjct: 552 ASKMKSLMSKKIMSKIW---SS---KERSGELTSSDTSESPASTVVEETKSTPSRSRRHS 605 Query: 280 VS 285 VS Sbjct: 606 VS 607 >XP_007155836.1 hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris] XP_007155837.1 hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris] ESW27830.1 hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris] ESW27831.1 hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris] Length = 628 Score = 67.0 bits (162), Expect = 7e-11 Identities = 42/62 (67%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = +1 Query: 106 AKKMKH--QEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHS 279 A KMK +K M +W SS SGELT+SDTSESPASTVVEETKSTPSRSRRHS Sbjct: 573 ASKMKGLMSKKIMSKIW---SS---KEKSGELTSSDTSESPASTVVEETKSTPSRSRRHS 626 Query: 280 VS 285 VS Sbjct: 627 VS 628 >XP_017406862.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna angularis] XP_017406867.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna angularis] XP_017406868.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna angularis] XP_017406873.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna angularis] XP_017406877.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Vigna angularis] KOM32410.1 hypothetical protein LR48_Vigan01g196600 [Vigna angularis] BAT75679.1 hypothetical protein VIGAN_01358500 [Vigna angularis var. angularis] Length = 621 Score = 66.6 bits (161), Expect = 1e-10 Identities = 42/62 (67%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = +1 Query: 106 AKKMKH--QEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHS 279 A KMK +K M +W SS SGELT+SDTSESPASTVVEETKSTPSRSRRHS Sbjct: 566 ASKMKGLISKKIMSKIW---SS---KERSGELTSSDTSESPASTVVEETKSTPSRSRRHS 619 Query: 280 VS 285 VS Sbjct: 620 VS 621 >XP_004511848.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Cicer arietinum] Length = 627 Score = 64.3 bits (155), Expect = 7e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPASTVVEETKSTPSRSRRHSVS Sbjct: 594 NGEITSSDTSESPASTVVEETKSTPSRSRRHSVS 627 >XP_003611607.1 phototropic-responsive NPH3 family protein [Medicago truncatula] AES94565.1 phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 630 Score = 64.3 bits (155), Expect = 7e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPASTVVEETKSTPSRSRRHSVS Sbjct: 597 NGEITSSDTSESPASTVVEETKSTPSRSRRHSVS 630 >XP_014631084.1 PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform X3 [Glycine max] KRH58084.1 hypothetical protein GLYMA_05G104900 [Glycine max] Length = 538 Score = 63.9 bits (154), Expect = 9e-10 Identities = 40/72 (55%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +1 Query: 73 HNGTSSKCWHVA-KKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETK 249 +NG +VA KMK L ++ S SG+L++SDTSESPASTVVEETK Sbjct: 471 NNGDKGNADNVAASKMKGFISKKILSKIWSSK----EKSGDLSSSDTSESPASTVVEETK 526 Query: 250 STPSRSRRHSVS 285 STPSRSRRHSVS Sbjct: 527 STPSRSRRHSVS 538 >XP_014631083.1 PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform X2 [Glycine max] Length = 585 Score = 63.9 bits (154), Expect = 9e-10 Identities = 40/72 (55%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +1 Query: 73 HNGTSSKCWHVA-KKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETK 249 +NG +VA KMK L ++ S SG+L++SDTSESPASTVVEETK Sbjct: 518 NNGDKGNADNVAASKMKGFISKKILSKIWSSK----EKSGDLSSSDTSESPASTVVEETK 573 Query: 250 STPSRSRRHSVS 285 STPSRSRRHSVS Sbjct: 574 STPSRSRRHSVS 585 >XP_006579937.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform X1 [Glycine max] XP_006579938.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform X1 [Glycine max] XP_006579939.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform X1 [Glycine max] KHN06013.1 BTB/POZ domain-containing protein NPY2 [Glycine soja] KRH58080.1 hypothetical protein GLYMA_05G104900 [Glycine max] KRH58081.1 hypothetical protein GLYMA_05G104900 [Glycine max] KRH58082.1 hypothetical protein GLYMA_05G104900 [Glycine max] KRH58083.1 hypothetical protein GLYMA_05G104900 [Glycine max] Length = 628 Score = 63.9 bits (154), Expect = 9e-10 Identities = 40/72 (55%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +1 Query: 73 HNGTSSKCWHVA-KKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETK 249 +NG +VA KMK L ++ S SG+L++SDTSESPASTVVEETK Sbjct: 561 NNGDKGNADNVAASKMKGFISKKILSKIWSSK----EKSGDLSSSDTSESPASTVVEETK 616 Query: 250 STPSRSRRHSVS 285 STPSRSRRHSVS Sbjct: 617 STPSRSRRHSVS 628 >XP_006579940.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Glycine max] XP_014631085.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Glycine max] XP_014631086.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Glycine max] KRH58085.1 hypothetical protein GLYMA_05G105000 [Glycine max] KRH58086.1 hypothetical protein GLYMA_05G105000 [Glycine max] KRH58087.1 hypothetical protein GLYMA_05G105000 [Glycine max] Length = 624 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 SGEL++SDTSESPASTVVEETKSTPSRSRRHS+S Sbjct: 591 SGELSSSDTSESPASTVVEETKSTPSRSRRHSLS 624 >KHN06014.1 BTB/POZ domain-containing protein NPY2 [Glycine soja] Length = 625 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 SGEL++SDTSESPASTVVEETKSTPSRSRRHS+S Sbjct: 592 SGELSSSDTSESPASTVVEETKSTPSRSRRHSLS 625 >KHN23238.1 BTB/POZ domain-containing protein NPY2 [Glycine soja] Length = 629 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 SGEL++SDTSESPASTVVEETKSTPSRSRRHS+S Sbjct: 596 SGELSSSDTSESPASTVVEETKSTPSRSRRHSLS 629 >XP_014625250.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Glycine max] KRH04438.1 hypothetical protein GLYMA_17G161500 [Glycine max] KRH04439.1 hypothetical protein GLYMA_17G161500 [Glycine max] KRH04440.1 hypothetical protein GLYMA_17G161500 [Glycine max] KRH04441.1 hypothetical protein GLYMA_17G161500 [Glycine max] Length = 629 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 SGEL++SDTSESPASTVVEETKSTPSRSRRHS+S Sbjct: 596 SGELSSSDTSESPASTVVEETKSTPSRSRRHSLS 629 >XP_016185946.1 PREDICTED: BTB/POZ domain-containing protein NPY3-like [Arachis ipaensis] Length = 616 Score = 62.8 bits (151), Expect = 2e-09 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = +1 Query: 106 AKKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 A KMK L ++ S SGE+T+ DTSESPASTV EETKSTPSRSRRHSVS Sbjct: 561 ANKMKGLMSKKILSKIWSSK----DRSGEITSDDTSESPASTVAEETKSTPSRSRRHSVS 616 >XP_015957107.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] Length = 621 Score = 62.8 bits (151), Expect = 2e-09 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = +1 Query: 106 AKKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 A KMK L ++ S SGE+T+ DTSESPASTV EETKSTPSRSRRHSVS Sbjct: 566 ANKMKGLMSKKILSKIWSSK----DRSGEITSDDTSESPASTVAEETKSTPSRSRRHSVS 621 >XP_015963833.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963834.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963835.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963836.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963837.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963838.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963840.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] XP_015963841.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis duranensis] Length = 617 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPASTV+EE+KSTPSRSRRHSVS Sbjct: 584 NGEITSSDTSESPASTVIEESKSTPSRSRRHSVS 617 >XP_016201639.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201642.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201643.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201644.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201645.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201646.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201647.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201648.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201649.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] XP_016201650.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Arachis ipaensis] Length = 624 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPASTV+EE+KSTPSRSRRHSVS Sbjct: 591 NGEITSSDTSESPASTVIEESKSTPSRSRRHSVS 624 >GAU26116.1 hypothetical protein TSUD_225790 [Trifolium subterraneum] Length = 565 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPASTVVEETKSTPSRSRR SVS Sbjct: 532 NGEITSSDTSESPASTVVEETKSTPSRSRRQSVS 565 >XP_019421019.1 PREDICTED: BTB/POZ domain-containing protein NPY4-like [Lupinus angustifolius] OIV94697.1 hypothetical protein TanjilG_25921 [Lupinus angustifolius] Length = 621 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 184 SGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 +GE+T+SDTSESPAST++EETKSTPSRSRR SVS Sbjct: 588 NGEITSSDTSESPASTIIEETKSTPSRSRRQSVS 621 >XP_014625249.1 PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X4 [Glycine max] Length = 539 Score = 58.5 bits (140), Expect = 7e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +1 Query: 106 AKKMKHQEKSMCLLWLYHSSGVVTSSSGELTNSDTSESPASTVVEETKSTPSRSRRHSVS 285 A KMK L ++ S S ++++SDTSESPASTVVEETKSTP+RSRRHSVS Sbjct: 484 ASKMKGFMSKKILSKIWSSK----EKSVDISSSDTSESPASTVVEETKSTPARSRRHSVS 539