BLASTX nr result
ID: Glycyrrhiza35_contig00019415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019415 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003628499.1 hypothetical protein MTR_8g059780 [Medicago trunc... 64 5e-11 >XP_003628499.1 hypothetical protein MTR_8g059780 [Medicago truncatula] AET02975.1 hypothetical protein MTR_8g059780 [Medicago truncatula] Length = 81 Score = 63.5 bits (153), Expect = 5e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 245 MADPVEVHFVLLSDQESESNRLHRQDWRVLIHFL 346 MA+PVEV+FVLLSDQESESNRLHRQD RVLIHFL Sbjct: 1 MANPVEVNFVLLSDQESESNRLHRQDRRVLIHFL 34