BLASTX nr result
ID: Glycyrrhiza35_contig00019305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019305 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY47577.1 hypothetical protein MANES_06G088900 [Manihot esculenta] 63 3e-10 XP_011072811.1 PREDICTED: formin-like protein 20 [Sesamum indicu... 58 1e-06 XP_006440663.1 hypothetical protein CICLE_v100188771mg, partial ... 57 3e-06 OMO54532.1 hypothetical protein COLO4_36430 [Corchorus olitorius] 57 3e-06 KCW83669.1 hypothetical protein EUGRSUZ_B005501, partial [Eucaly... 57 3e-06 KRH03523.1 hypothetical protein GLYMA_17G1028001, partial [Glyci... 57 3e-06 GAV71548.1 FH2 domain-containing protein/PTEN_C2 domain-containi... 57 3e-06 XP_006374444.1 hypothetical protein POPTR_0015s072201g, partial ... 57 3e-06 XP_008393189.1 PREDICTED: formin-like protein 20 [Malus domestica] 57 3e-06 XP_007155280.1 hypothetical protein PHAVU_003G1878001g, partial ... 57 3e-06 EYU35792.1 hypothetical protein MIMGU_mgv1a0002482mg, partial [E... 57 3e-06 EYU34414.1 hypothetical protein MIMGU_mgv1a025175mg, partial [Er... 57 3e-06 KDO55465.1 hypothetical protein CISIN_1g0011562mg, partial [Citr... 57 3e-06 XP_019081947.1 PREDICTED: formin-like protein 20, partial [Vitis... 57 3e-06 BAT76555.1 hypothetical protein VIGAN_01457600 [Vigna angularis ... 57 3e-06 XP_006376809.1 hypothetical protein POPTR_0012s069802g, partial ... 57 3e-06 CBI15184.3 unnamed protein product, partial [Vitis vinifera] 57 3e-06 OAY31079.1 hypothetical protein MANES_14G082200 [Manihot esculenta] 57 3e-06 KDP31292.1 hypothetical protein JCGZ_11668 [Jatropha curcas] 57 3e-06 EOY21944.1 Actin-binding FH2 protein isoform 4 [Theobroma cacao] 57 3e-06 >OAY47577.1 hypothetical protein MANES_06G088900 [Manihot esculenta] Length = 80 Score = 63.2 bits (152), Expect = 3e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 8 INSLGDLQKPIRRLPVEEPSEQRHLMALFLPRSDPNR 118 +NSL DL+KPIRR+PV+E SEQRHL+ LFLPRSDPNR Sbjct: 1 MNSLRDLKKPIRRVPVKEVSEQRHLITLFLPRSDPNR 37 >XP_011072811.1 PREDICTED: formin-like protein 20 [Sesamum indicum] XP_011072812.1 PREDICTED: formin-like protein 20 [Sesamum indicum] XP_011072813.1 PREDICTED: formin-like protein 20 [Sesamum indicum] XP_011072814.1 PREDICTED: formin-like protein 20 [Sesamum indicum] Length = 463 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 94 KQRHQMALFRRFFYRKPPDRLLEISERVYVF 2 +Q+++ ALFRRFFYRKPPDRLLEISERVYVF Sbjct: 6 RQQNEGALFRRFFYRKPPDRLLEISERVYVF 36 >XP_006440663.1 hypothetical protein CICLE_v100188771mg, partial [Citrus clementina] ESR53903.1 hypothetical protein CICLE_v100188771mg, partial [Citrus clementina] Length = 526 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >OMO54532.1 hypothetical protein COLO4_36430 [Corchorus olitorius] Length = 672 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >KCW83669.1 hypothetical protein EUGRSUZ_B005501, partial [Eucalyptus grandis] Length = 704 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >KRH03523.1 hypothetical protein GLYMA_17G1028001, partial [Glycine max] KRH03524.1 hypothetical protein GLYMA_17G1028001, partial [Glycine max] Length = 711 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >GAV71548.1 FH2 domain-containing protein/PTEN_C2 domain-containing protein, partial [Cephalotus follicularis] Length = 716 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >XP_006374444.1 hypothetical protein POPTR_0015s072201g, partial [Populus trichocarpa] ERP52241.1 hypothetical protein POPTR_0015s072201g, partial [Populus trichocarpa] Length = 725 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >XP_008393189.1 PREDICTED: formin-like protein 20 [Malus domestica] Length = 734 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >XP_007155280.1 hypothetical protein PHAVU_003G1878001g, partial [Phaseolus vulgaris] ESW27274.1 hypothetical protein PHAVU_003G1878001g, partial [Phaseolus vulgaris] Length = 747 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >EYU35792.1 hypothetical protein MIMGU_mgv1a0002482mg, partial [Erythranthe guttata] Length = 748 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >EYU34414.1 hypothetical protein MIMGU_mgv1a025175mg, partial [Erythranthe guttata] Length = 793 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >KDO55465.1 hypothetical protein CISIN_1g0011562mg, partial [Citrus sinensis] Length = 813 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >XP_019081947.1 PREDICTED: formin-like protein 20, partial [Vitis vinifera] Length = 876 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >BAT76555.1 hypothetical protein VIGAN_01457600 [Vigna angularis var. angularis] Length = 939 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >XP_006376809.1 hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] XP_006376810.1 hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] ERP54606.1 hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] ERP54607.1 hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] Length = 1004 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >CBI15184.3 unnamed protein product, partial [Vitis vinifera] Length = 1010 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >OAY31079.1 hypothetical protein MANES_14G082200 [Manihot esculenta] Length = 1027 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >KDP31292.1 hypothetical protein JCGZ_11668 [Jatropha curcas] Length = 1054 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26 >EOY21944.1 Actin-binding FH2 protein isoform 4 [Theobroma cacao] Length = 1069 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 79 MALFRRFFYRKPPDRLLEISERVYVF 2 MALFRRFFYRKPPDRLLEISERVYVF Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVF 26