BLASTX nr result
ID: Glycyrrhiza35_contig00019120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00019120 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 87 9e-18 XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 87 9e-18 KHN15060.1 Putative AC transposase [Glycine soja] 81 9e-16 GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterran... 80 1e-15 KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] 78 1e-15 XP_014625130.1 PREDICTED: zinc finger BED domain-containing prot... 78 8e-15 KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] 78 1e-14 KHN03605.1 Putative AC transposase [Glycine soja] 78 1e-14 XP_016199355.1 PREDICTED: zinc finger BED domain-containing prot... 77 3e-14 XP_015935840.1 PREDICTED: zinc finger BED domain-containing prot... 76 4e-14 XP_014621068.1 PREDICTED: zinc finger BED domain-containing prot... 76 4e-14 XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 76 4e-14 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 74 2e-13 XP_019452720.1 PREDICTED: zinc finger BED domain-containing prot... 72 9e-13 XP_019452712.1 PREDICTED: zinc finger BED domain-containing prot... 72 9e-13 XP_019452679.1 PREDICTED: zinc finger BED domain-containing prot... 72 9e-13 XP_004493926.1 PREDICTED: zinc finger BED domain-containing prot... 70 4e-12 GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterran... 69 2e-11 XP_017437935.1 PREDICTED: zinc finger BED domain-containing prot... 65 3e-10 XP_014508793.1 PREDICTED: zinc finger BED domain-containing prot... 64 8e-10 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 86.7 bits (213), Expect = 9e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSH+RDIKP+PH+HLAQYDTVPNNHLDH E L NHQLTDSET+S Sbjct: 303 DSHIRDIKPMPHDHLAQYDTVPNNHLDHSEGLCNHQLTDSETLS 346 Score = 73.2 bits (178), Expect = 5e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 NHELDNT+EP N +PEN ES+P DQL+NAEAP+++Q VDS+APLNN Sbjct: 81 NHELDNTEEPPNNKPENFESLPIDQLSNAEAPDNDQLVDSEAPLNN 126 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 86.7 bits (213), Expect = 9e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSH+RDIKP+PH+HLAQYDTVPNNHLDH E L NHQLTDSET+S Sbjct: 311 DSHIRDIKPMPHDHLAQYDTVPNNHLDHSEGLCNHQLTDSETLS 354 Score = 73.2 bits (178), Expect = 5e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 NHELDNT+EP N +PEN ES+P DQL+NAEAP+++Q VDS+APLNN Sbjct: 89 NHELDNTEEPPNNKPENFESLPIDQLSNAEAPDNDQLVDSEAPLNN 134 >KHN15060.1 Putative AC transposase [Glycine soja] Length = 1154 Score = 80.9 bits (198), Expect = 9e-16 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +3 Query: 159 QDSHLRDIKPIPHNHLAQYDTVP-NNHLDHPEALSNHQLTDSETMS 293 QD HL DIKP+PHNHLAQYDT+P N+H+DH EA+SNHQLTDSET+S Sbjct: 393 QDIHLTDIKPLPHNHLAQYDTLPSNHHMDHSEAVSNHQLTDSETLS 438 >GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterraneum] Length = 628 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 159 QDSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSE 284 +DSH+RDIKPI H+HL+QYDTVPNNHLDH EAL NHQLTDS+ Sbjct: 271 EDSHIRDIKPIQHDHLSQYDTVPNNHLDHSEALCNHQLTDSD 312 Score = 65.5 bits (158), Expect = 2e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPN-DQLNNAEAPNDNQPVDSKAPLNN 139 NHELDNT E N EP+NSES+PN DQ NA+AP++NQ VDS+A LNN Sbjct: 52 NHELDNTIETPNDEPDNSESLPNEDQSGNADAPDNNQQVDSEATLNN 98 >KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] Length = 210 Score = 77.8 bits (190), Expect = 1e-15 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +3 Query: 159 QDSHLRDIKPIPHNHLAQYDTVPNN-HLDHPEALSNHQLTDSETMS 293 QD HL DIKP+PHNHLAQYDT+PNN H+DH EA+SNHQLT ET+S Sbjct: 102 QDIHLTDIKPLPHNHLAQYDTLPNNHHMDHSEAVSNHQLTHFETLS 147 >XP_014625130.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014625131.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH03658.1 hypothetical protein GLYMA_17G111500 [Glycine max] Length = 1154 Score = 78.2 bits (191), Expect = 8e-15 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +3 Query: 159 QDSHLRDIKPIPHNHLAQYDTVP-NNHLDHPEALSNHQLTDSETMS 293 QD HL DIKP+PHNHLAQYDT+P N+H+DH EA+SNHQLT SET+S Sbjct: 393 QDIHLTDIKPLPHNHLAQYDTLPSNHHMDHSEAVSNHQLTHSETLS 438 >KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] Length = 494 Score = 77.8 bits (190), Expect = 1e-14 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +3 Query: 159 QDSHLRDIKPIPHNHLAQYDTVPNN-HLDHPEALSNHQLTDSETMS 293 QD HL DIKP+PHNHLAQYDT+PNN H+DH EA+SNHQLT ET+S Sbjct: 293 QDIHLTDIKPLPHNHLAQYDTLPNNHHMDHSEAVSNHQLTHFETLS 338 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 N ELDNT+E N E EN + +PN+Q +N P NQ V+S+APL N Sbjct: 72 NLELDNTEELPNSESENPKLLPNNQSSNDGGPLSNQHVESEAPLKN 117 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 192 PHNHLAQYDTVPNNHLDHPEALSNHQLTDSET 287 P N L ++T+PNN + H E +++ + SET Sbjct: 138 PSNQLLNFETLPNNGVLHSEHQTSNDVVLSET 169 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 77.8 bits (190), Expect = 1e-14 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 D HL DIKP+PHNHLA YDT+ NNH+DH EA+SNHQLT SET+S Sbjct: 421 DIHLTDIKPLPHNHLAHYDTLSNNHMDHSEAVSNHQLTHSETLS 464 >XP_016199355.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] XP_016199363.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] Length = 1077 Score = 76.6 bits (187), Expect = 3e-14 Identities = 43/96 (44%), Positives = 57/96 (59%), Gaps = 1/96 (1%) Frame = +3 Query: 9 SWTTPKNLVTRSQRILNQYPTTS*TMLKPQTTINQWTPRHHST-IHCPVLNQDSHLRDIK 185 S T P N ++ + + + + T M+ P+ + Q P HS + DSHL DIK Sbjct: 271 STTDPNNQLSLPENLPDHHQFTDLHMI-PEDHLPQPEPLPHSEPLPSSEPLSDSHLADIK 329 Query: 186 PIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 PIP +HLA YDT+PNNHL H E LSNHQL +SE +S Sbjct: 330 PIPEDHLAHYDTLPNNHLHHSEELSNHQLANSEALS 365 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 N E DNTKEP N EPE +E++PN+Q + P+ NQPVD++ PLNN Sbjct: 82 NPESDNTKEPLNNEPEKTEALPNNQSGDTGPPDTNQPVDTEVPLNN 127 >XP_015935840.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] XP_015935843.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] Length = 1088 Score = 76.3 bits (186), Expect = 4e-14 Identities = 44/99 (44%), Positives = 59/99 (59%), Gaps = 4/99 (4%) Frame = +3 Query: 9 SWTTPKNLVTRSQRILNQYPTTS*TMLKPQTTINQWTPRHHSTIHCPVLNQ----DSHLR 176 S T P N ++ + + + + T M+ P+ + Q P HS P+ + DSHL Sbjct: 282 STTDPNNQLSLPENLPDHHQFTDLHMI-PEDHLPQPEPLPHSE---PLPSNEPLSDSHLA 337 Query: 177 DIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DIKPIP +HLA YDT+PNNHL H E LSNHQL +SE +S Sbjct: 338 DIKPIPEDHLAHYDTLPNNHLHHSEELSNHQLANSEALS 376 Score = 63.5 bits (153), Expect = 1e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 N E DNTKEP N EPE +E++PN+QL + P+ NQPVD++ PLNN Sbjct: 82 NSESDNTKEPLNNEPEKTEALPNNQLGDTGPPDTNQPVDTQVPLNN 127 >XP_014621068.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20149.1 hypothetical protein GLYMA_13G159800 [Glycine max] Length = 1100 Score = 76.3 bits (186), Expect = 4e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 D HL DIKP+PHNHLA YDT+ NNH+DH EA+SNHQLT S+T+S Sbjct: 341 DIHLTDIKPLPHNHLAHYDTLSNNHMDHSEAVSNHQLTHSKTLS 384 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 2 NHELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKAPLNN 139 N ELDNTKE N E EN + +P++Q +N E P+ NQ V+S+A LNN Sbjct: 73 NRELDNTKELANSESENPKLLPDNQSSNDEGPHSNQHVESEARLNN 118 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 76.3 bits (186), Expect = 4e-14 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 D HL DIKP+PHNHLA YD++ NNH+DH EA+SNHQLT SET+S Sbjct: 421 DIHLTDIKPLPHNHLAHYDSLSNNHMDHSEAVSNHQLTHSETLS 464 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 74.3 bits (181), Expect = 2e-13 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSHL DIKPIPHNHLAQYDT+PN+H+ H EA++NH+L SE +S Sbjct: 496 DSHLIDIKPIPHNHLAQYDTLPNSHMHHSEAVANHELAHSEALS 539 >XP_019452720.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X3 [Lupinus angustifolius] Length = 920 Score = 72.4 bits (176), Expect = 9e-13 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSHL DIKPIPHNHL+QYD P+NHLDH E L+NHQ+ + ET S Sbjct: 167 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLANHQVANLETFS 210 >XP_019452712.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Lupinus angustifolius] Length = 921 Score = 72.4 bits (176), Expect = 9e-13 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSHL DIKPIPHNHL+QYD P+NHLDH E L+NHQ+ + ET S Sbjct: 168 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLANHQVANLETFS 211 >XP_019452679.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452687.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452695.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452705.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] Length = 943 Score = 72.4 bits (176), Expect = 9e-13 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 DSHL DIKPIPHNHL+QYD P+NHLDH E L+NHQ+ + ET S Sbjct: 190 DSHLTDIKPIPHNHLSQYDIPPSNHLDHSENLANHQVANLETFS 233 >XP_004493926.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_004493927.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569418.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569419.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] Length = 1274 Score = 70.5 bits (171), Expect = 4e-12 Identities = 41/94 (43%), Positives = 57/94 (60%), Gaps = 3/94 (3%) Frame = +3 Query: 21 PKNLVTRSQRILNQYPTTS*TMLKPQTTINQWTPRHHSTIHCPVLNQ---DSHLRDIKPI 191 P N ++ + +LN + T M+ P+ + Q P P ++ DSH D+KP+ Sbjct: 471 PNNQLSDQEILLNNHQFTDLHMI-PEDHLPQ--PESLPISESPPSSEPMADSHNTDVKPM 527 Query: 192 PHNHLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 PHNHL +Y +PN+HLDH EALSNHQL +SETMS Sbjct: 528 PHNHLQEY--LPNSHLDHSEALSNHQLANSETMS 559 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 4/49 (8%) Frame = +2 Query: 5 HELDNTKEPRNKEPENSESIPNDQLNNAEAPNDNQPVDSKA----PLNN 139 +ELDNTKE +N E ENS+S+ N+Q+ +A AP DNQP D +A P+NN Sbjct: 100 NELDNTKECQNNELENSQSLVNNQVGDAGAPKDNQPFDLEATLDMPMNN 148 >GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterraneum] Length = 912 Score = 68.6 bits (166), Expect = 2e-11 Identities = 35/91 (38%), Positives = 52/91 (57%) Frame = +3 Query: 21 PKNLVTRSQRILNQYPTTS*TMLKPQTTINQWTPRHHSTIHCPVLNQDSHLRDIKPIPHN 200 P N ++R + IL+ + M+ + + + H DSH D + I HN Sbjct: 400 PNNQLSRQEIILDNHHFADHHMIPEDQLPHPESQPNSELPHSSEPLADSHNTDAEQIHHN 459 Query: 201 HLAQYDTVPNNHLDHPEALSNHQLTDSETMS 293 HL +YDT+PN+HLDH EAL+NHQL ++ET+S Sbjct: 460 HLQEYDTLPNSHLDHHEALANHQLANTETLS 490 >XP_017437935.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna angularis] KOM33000.1 hypothetical protein LR48_Vigan01g255600 [Vigna angularis] BAT76315.1 hypothetical protein VIGAN_01429700 [Vigna angularis var. angularis] Length = 1231 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +3 Query: 162 DSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQL-TDSETMS 293 DSHL DIKPI HNHLAQYDT+PN+H+ H EA++N QL SE +S Sbjct: 472 DSHLTDIKPISHNHLAQYDTLPNSHMHHSEAVANDQLVAHSEALS 516 >XP_014508793.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] XP_014508794.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] Length = 1233 Score = 63.9 bits (154), Expect = 8e-10 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +3 Query: 147 PVLNQDSHLRDIKPIPHNHLAQYDTVPNNHLDHPEALSNHQL-TDSETMS 293 P SHL DIKPI HNHLAQYDT+PN+H+ H EA++N QL SE +S Sbjct: 469 PASEPGSHLTDIKPISHNHLAQYDTLPNSHMHHSEAVANDQLVVHSEALS 518