BLASTX nr result
ID: Glycyrrhiza35_contig00018941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00018941 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41721.1 Pentatricopeptide repeat-containing protein, mitochon... 84 9e-17 XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 3e-14 KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] 77 3e-14 XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 6e-09 BAU00371.1 hypothetical protein VIGAN_10195800 [Vigna angularis ... 58 1e-07 XP_014521217.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_014520925.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_007156631.1 hypothetical protein PHAVU_002G004400g [Phaseolus... 58 2e-07 XP_017427849.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 6e-07 XP_017423737.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 KOM54794.1 hypothetical protein LR48_Vigan10g068600 [Vigna angul... 55 1e-06 XP_017439682.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_017427263.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 XP_015938629.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 3e-06 XP_016175852.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 >KHN41721.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 737 Score = 84.3 bits (207), Expect = 9e-17 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +3 Query: 111 HRSNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +R NHS+P KPP PF +++ECDESLLLHYL+ GWH +A LLQ+ SGGD H+RVV Sbjct: 32 YRVNHSRPRKPPFPFPKRTECDESLLLHYLSNGWHDDARNLLQNSSGGDLHSRVV 86 >XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628081.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628082.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628086.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628089.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] Length = 766 Score = 77.0 bits (188), Expect = 3e-14 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = +3 Query: 111 HRSNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +R NHS+P K P PF +++ECDESLLLHYL+ GW ++A LLQ+ SGGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] Length = 894 Score = 77.0 bits (188), Expect = 3e-14 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = +3 Query: 111 HRSNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +R NHS+P K P PF +++ECDESLLLHYL+ GW ++A LLQ+ SGGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Cicer arietinum] Length = 741 Score = 62.0 bits (149), Expect = 6e-09 Identities = 31/53 (58%), Positives = 35/53 (66%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 SNHS KP PF K E DES L HYLTKG HHEA ++LQ+F + H RVV Sbjct: 27 SNHSHSFKPLFPFPPKHEFDESQLFHYLTKGLHHEARKILQTFPCKNPHTRVV 79 >BAU00371.1 hypothetical protein VIGAN_10195800 [Vigna angularis var. angularis] Length = 718 Score = 58.2 bits (139), Expect = 1e-07 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQ+ SGGD HARVV Sbjct: 26 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVV 67 >XP_014521217.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna radiata var. radiata] Length = 718 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 168 ECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 ECDE LLLHYL+ G HHEA LLQ+ SGGD HARVV Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVV 67 >XP_014520925.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna radiata var. radiata] Length = 718 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 168 ECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 ECDE LLLHYL+ G HHEA LLQ+ SGGD HARVV Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVV 67 >XP_007156631.1 hypothetical protein PHAVU_002G004400g [Phaseolus vulgaris] ESW28625.1 hypothetical protein PHAVU_002G004400g [Phaseolus vulgaris] Length = 718 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 168 ECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 ECDE LLLHYL+ G HH+A LLQS SGGD HARVV Sbjct: 32 ECDEPLLLHYLSNGCHHQARNLLQSSSGGDLHARVV 67 >XP_017427849.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] XP_017427850.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] KOM44876.1 hypothetical protein LR48_Vigan06g018200 [Vigna angularis] BAU00380.1 hypothetical protein VIGAN_10196700 [Vigna angularis var. angularis] Length = 718 Score = 56.2 bits (134), Expect = 6e-07 Identities = 31/53 (58%), Positives = 33/53 (62%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQS S GD HARVV Sbjct: 26 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQSSSRGDLHARVV 67 >XP_017423737.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] Length = 196 Score = 55.1 bits (131), Expect = 7e-07 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQ+ SGGD ARVV Sbjct: 36 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVV 77 >KOM54794.1 hypothetical protein LR48_Vigan10g068600 [Vigna angularis] Length = 244 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQ+ SGGD ARVV Sbjct: 36 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVV 77 >XP_017439682.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] Length = 415 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQ+ SGGD ARVV Sbjct: 36 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVV 77 >XP_017427263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] KOM44883.1 hypothetical protein LR48_Vigan06g018900 [Vigna angularis] Length = 718 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +3 Query: 117 SNHSQPSKPPLPFTRKSECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 +NHSQ ECDE LLLHYL+ G HHEA LLQ+ SGGD ARVV Sbjct: 26 TNHSQ-----------CECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVV 67 >XP_015938629.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Arachis duranensis] XP_015938630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Arachis duranensis] XP_015938632.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Arachis duranensis] Length = 732 Score = 54.3 bits (129), Expect = 3e-06 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +3 Query: 123 HSQPSKPPLPFTRKS----ECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 HSQP LPF R + E +++LLL YL+ GWHHEA +LL S G HAR+V Sbjct: 23 HSQPFNHALPFFRTNGPTLEFNDTLLLRYLSNGWHHEARDLLYKSSRGHPHARIV 77 >XP_016175852.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Arachis ipaensis] Length = 732 Score = 53.9 bits (128), Expect = 4e-06 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Frame = +3 Query: 123 HSQPSKPPLPFTRKS----ECDESLLLHYLTKGWHHEA*ELLQSFSGGDRHARVV 275 HSQP LPF R E +++LLL YL+ GWHHEA +LL S G HAR+V Sbjct: 23 HSQPFNHALPFFRTKGPTLEFNDTLLLRYLSNGWHHEARDLLYKSSRGHPHARIV 77