BLASTX nr result
ID: Glycyrrhiza35_contig00018558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00018558 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH57989.1 hypothetical protein GLYMA_05G098800 [Glycine max] 66 1e-10 KHN02627.1 Putative cadmium/zinc-transporting ATPase HMA1, chlor... 59 5e-08 XP_004509102.1 PREDICTED: probable cadmium/zinc-transporting ATP... 58 1e-07 XP_003550994.1 PREDICTED: probable cadmium/zinc-transporting ATP... 55 1e-06 XP_007155886.1 hypothetical protein PHAVU_003G240100g [Phaseolus... 52 9e-06 >KRH57989.1 hypothetical protein GLYMA_05G098800 [Glycine max] Length = 832 Score = 66.2 bits (160), Expect = 1e-10 Identities = 38/48 (79%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -2 Query: 146 SNLKMEAVSYSIPSTKL-QSLHIYTRATRIRSSKFTLRLRPPSISIKP 6 SNLKMEA+SYSIPSTKL SLHIYT TRIRSS L LRPP ISIKP Sbjct: 5 SNLKMEAISYSIPSTKLHSSLHIYTGVTRIRSS--NLLLRPPPISIKP 50 >KHN02627.1 Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic [Glycine soja] Length = 824 Score = 58.9 bits (141), Expect = 5e-08 Identities = 34/44 (77%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -2 Query: 134 MEAVSYSIPSTKLQS-LHIYTRATRIRSSKFTLRLRPPSISIKP 6 MEA+SYSIPSTKL S LHIYT TRIRSS L LRPP ISIKP Sbjct: 1 MEAISYSIPSTKLHSSLHIYTGVTRIRSS--NLLLRPPPISIKP 42 >XP_004509102.1 PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic [Cicer arietinum] Length = 839 Score = 57.8 bits (138), Expect = 1e-07 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 134 MEAVSYSIPSTKLQSL-HIYTRATRIRSSKFTLRLRPPSISIKPY 3 MEAVSYSIPSTK QSL HI+T+ T I+SS T RLR ISIKP+ Sbjct: 1 MEAVSYSIPSTKFQSLQHIHTKTTIIQSSNLTFRLRSSPISIKPF 45 >XP_003550994.1 PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic [Glycine max] KHN27067.1 Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic [Glycine soja] KRH04519.1 hypothetical protein GLYMA_17G166800 [Glycine max] Length = 817 Score = 54.7 bits (130), Expect = 1e-06 Identities = 32/44 (72%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -2 Query: 134 MEAVSYSIPSTKL-QSLHIYTRATRIRSSKFTLRLRPPSISIKP 6 MEA+ YSIPSTKL SLHIYT TRIRS L LRPP ISIKP Sbjct: 1 MEAIPYSIPSTKLHSSLHIYTGVTRIRS----LPLRPPPISIKP 40 >XP_007155886.1 hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris] ESW27880.1 hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris] Length = 826 Score = 52.4 bits (124), Expect = 9e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -2 Query: 134 MEAVSYSIPSTKLQSLHIYTRATRIRSSKFTLRLRPPSISIKP 6 ME + Y+IPSTKL SL IYTRAT I S TL RPP ISIKP Sbjct: 1 METLPYTIPSTKLHSLRIYTRATPIPFS--TLPFRPPGISIKP 41