BLASTX nr result
ID: Glycyrrhiza35_contig00017015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00017015 (712 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterran... 63 7e-08 GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterran... 63 7e-08 >GAU22365.1 hypothetical protein TSUD_106940 [Trifolium subterraneum] Length = 623 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = +2 Query: 137 EGLGLMIIVRGMRKSFC-EELKHSFSEGIGITAPKARTRDK 256 EGLGLM I+RGM++SFC E+LK SF +GIGITAPKAR RDK Sbjct: 54 EGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPKARARDK 94 >GAU22366.1 hypothetical protein TSUD_106930 [Trifolium subterraneum] Length = 625 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = +2 Query: 137 EGLGLMIIVRGMRKSFC-EELKHSFSEGIGITAPKARTRDK 256 EGLGLM I+RGM++SFC E+LK SF +GIGITAPKAR RDK Sbjct: 56 EGLGLMRIIRGMQRSFCCEDLKKSFEKGIGITAPKARARDK 96