BLASTX nr result
ID: Glycyrrhiza35_contig00016835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00016835 (659 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009318202.1 ribosomal protein L32 (chloroplast) [Corylus avel... 77 2e-15 >YP_009318202.1 ribosomal protein L32 (chloroplast) [Corylus avellana] YP_009318282.1 ribosomal protein L32 (chloroplast) [Corylus heterophylla] YP_009318125.1 ribosomal protein L32 (chloroplast) [Corylus fargesii] YP_009331522.1 ribosomal protein L32 (chloroplast) [Corylus chinensis] AOZ20326.1 ribosomal protein L32 (chloroplast) [Corylus fargesii] AOZ20404.1 ribosomal protein L32 (chloroplast) [Corylus avellana] AOZ20484.1 ribosomal protein L32 (chloroplast) [Corylus heterophylla] APF31771.1 ribosomal protein L32 (chloroplast) [Corylus chinensis] Length = 56 Score = 77.0 bits (188), Expect = 2e-15 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +3 Query: 69 FLLQKKLLEFPVKIDRANEKAFNAVRYPFFFQKVLRIFFFDIEVRFFGTAIQ 224 FLL KKL EFPV+ D ANEKAFNA +YP FQ LRI FFDIEVRFFGTAI+ Sbjct: 3 FLLYKKLFEFPVERDFANEKAFNATQYPSIFQIFLRIRFFDIEVRFFGTAIK 54