BLASTX nr result
ID: Glycyrrhiza35_contig00016267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00016267 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003604570.2 gamma interferon inducible lysosomal thiol reduct... 57 2e-07 GAU13924.1 hypothetical protein TSUD_262510 [Trifolium subterran... 54 1e-06 >XP_003604570.2 gamma interferon inducible lysosomal thiol reductase [Medicago truncatula] AES86767.2 gamma interferon inducible lysosomal thiol reductase [Medicago truncatula] Length = 263 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 352 TTYDSDEKTNSFQPVCYVGEARNLTLITTNHQIKD 248 T YD + KTNSF PVCYV EA+NLTL+TT+HQIK+ Sbjct: 229 TYYDLNAKTNSFHPVCYVDEAKNLTLLTTSHQIKE 263 >GAU13924.1 hypothetical protein TSUD_262510 [Trifolium subterraneum] Length = 161 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 355 TTTYDSDEKTNSFQPVCYVGEARNLTLITTNHQIKD 248 T TY D K NSF PVCYV EA+NLTL+TTNHQIK+ Sbjct: 127 TKTY-YDAKINSFHPVCYVDEAKNLTLLTTNHQIKE 161