BLASTX nr result
ID: Glycyrrhiza35_contig00015998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015998 (609 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013453464.1 hypothetical protein MTR_5g015205 [Medicago trunc... 80 2e-16 >XP_013453464.1 hypothetical protein MTR_5g015205 [Medicago truncatula] KEH27495.1 hypothetical protein MTR_5g015205 [Medicago truncatula] Length = 97 Score = 80.5 bits (197), Expect = 2e-16 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 167 VFLMESWRPPKDTKRKKIQQK*EAWSKATPQQLQLKLQAPSSLC-DRSPKKYLYPTT 334 +F+ME+WRP K +K ++ K AWSKATPQQLQLKLQAPS LC D SP KYLYPTT Sbjct: 38 IFVMENWRPLKRSKEEEDTMKVRAWSKATPQQLQLKLQAPSLLCDDHSPNKYLYPTT 94