BLASTX nr result
ID: Glycyrrhiza35_contig00015847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015847 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_043855753.1 MULTISPECIES: PilZ domain-containing protein [Bra... 73 3e-15 >WP_043855753.1 MULTISPECIES: PilZ domain-containing protein [Bradyrhizobium] OCX28685.1 hypothetical protein QU42_21775 [Bradyrhizobium sp. UASWS1016] Length = 95 Score = 72.8 bits (177), Expect = 3e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 84 MADDHHRPTTASTQQALPTNERRGDARRRVFKSGTIEFGS 203 MADDH RPT+ASTQQALPT +RR DARRRVFKSG IEFGS Sbjct: 1 MADDHQRPTSASTQQALPTTDRRADARRRVFKSGAIEFGS 40