BLASTX nr result
ID: Glycyrrhiza35_contig00015841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015841 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007154727.1 hypothetical protein PHAVU_003G142400g [Phaseolus... 56 2e-07 >XP_007154727.1 hypothetical protein PHAVU_003G142400g [Phaseolus vulgaris] ESW26721.1 hypothetical protein PHAVU_003G142400g [Phaseolus vulgaris] Length = 162 Score = 55.8 bits (133), Expect = 2e-07 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 190 RRFVGGGNCDVLFT*MKAEKVWRMG-MGDMQILPGSRHR 303 +RF GG NCD F MK EK WR+G MGDMQILPGSRHR Sbjct: 3 KRFAGGENCDA-FALMKTEKGWRLGSMGDMQILPGSRHR 40