BLASTX nr result
ID: Glycyrrhiza35_contig00015590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015590 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014499608.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 KHN28549.1 Pentatricopeptide repeat-containing protein [Glycine ... 60 4e-08 XP_006604178.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-07 GAU11906.1 hypothetical protein TSUD_195290 [Trifolium subterran... 58 2e-07 KYP46803.1 Pentatricopeptide repeat-containing protein At1g77405... 57 3e-07 XP_017423075.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_007161694.1 hypothetical protein PHAVU_001G090600g [Phaseolus... 57 3e-07 XP_003603474.2 PPR containing plant-like protein [Medicago trunc... 55 2e-06 XP_012574691.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 7e-06 >XP_014499608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vigna radiata var. radiata] Length = 440 Score = 60.1 bits (144), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GIW RYR++MKVKP+MTRKGYPE++ Sbjct: 406 VHKRIKDGIWNRYRQMMKVKPVMTRKGYPEME 437 >KHN28549.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 444 Score = 59.7 bits (143), Expect = 4e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GIW RYR++MKVKP+M RKGYPE+D Sbjct: 410 VHKRIKDGIWNRYRQMMKVKPVMARKGYPEMD 441 >XP_006604178.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Glycine max] KRG94641.1 hypothetical protein GLYMA_19G099200 [Glycine max] Length = 446 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GIW RYR++MKVKP+M RKGYPE++ Sbjct: 412 VHKRIKDGIWNRYRQMMKVKPVMARKGYPEME 443 >GAU11906.1 hypothetical protein TSUD_195290 [Trifolium subterraneum] Length = 432 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GI ERY+R MKVKP+MTRKGYPE++ Sbjct: 398 VHQRIKDGILERYKRTMKVKPVMTRKGYPELE 429 >KYP46803.1 Pentatricopeptide repeat-containing protein At1g77405 family [Cajanus cajan] Length = 335 Score = 57.0 bits (136), Expect = 3e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 +H RIK+G+W RYR+VMKVKP+M RKGYPE++ Sbjct: 299 LHKRIKDGMWNRYRQVMKVKPVMARKGYPEME 330 >XP_017423075.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vigna angularis] KOM43068.1 hypothetical protein LR48_Vigan05g067200 [Vigna angularis] BAT92841.1 hypothetical protein VIGAN_07168600 [Vigna angularis var. angularis] Length = 445 Score = 57.0 bits (136), Expect = 3e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GIW RYR++MKVKP+MTRKGY E++ Sbjct: 411 VHKRIKDGIWNRYRQMMKVKPVMTRKGYQEME 442 >XP_007161694.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] XP_007161695.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] ESW33688.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] ESW33689.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] Length = 445 Score = 57.0 bits (136), Expect = 3e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK+GIW RYR++MKVKP+M R+GYPE++ Sbjct: 411 VHKRIKDGIWNRYRQMMKVKPVMARRGYPEME 442 >XP_003603474.2 PPR containing plant-like protein [Medicago truncatula] AES73725.2 PPR containing plant-like protein [Medicago truncatula] Length = 441 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 VH RIK GI ERY+R MKVKP+MTRKGYPE++ Sbjct: 407 VHRRIKCGILERYKRTMKVKPVMTRKGYPELE 438 >XP_012574691.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405, partial [Cicer arietinum] Length = 374 Score = 53.1 bits (126), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +1 Query: 49 VHDRIKEGIWERYRRVMKVKPIMTRKGYPEID 144 +H RIK+GI ERYRR MK KP+M RKGYPE + Sbjct: 340 MHQRIKDGILERYRRTMKFKPVMNRKGYPEFE 371