BLASTX nr result
ID: Glycyrrhiza35_contig00015563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015563 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004512142.1 PREDICTED: transmembrane protein 136-like isoform... 60 3e-08 GAU18765.1 hypothetical protein TSUD_80540 [Trifolium subterraneum] 54 8e-06 GAU18764.1 hypothetical protein TSUD_80530 [Trifolium subterraneum] 54 1e-05 >XP_004512142.1 PREDICTED: transmembrane protein 136-like isoform X2 [Cicer arietinum] XP_004512143.1 PREDICTED: transmembrane protein 136-like isoform X1 [Cicer arietinum] Length = 249 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 331 MATLVFSEGWIVFPFFFMFLTIYLIGYFIVFRNRSTK 441 M TL+ EGW+V PFFFMFL+IYLIGYFIVFRNR+ K Sbjct: 1 MGTLLL-EGWLVLPFFFMFLSIYLIGYFIVFRNRTLK 36 >GAU18765.1 hypothetical protein TSUD_80540 [Trifolium subterraneum] Length = 250 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +1 Query: 331 MATLVFSEGWIVFPFFFMFLTIYLIGYFIVFRNRSTK 441 M L+ + W+ FPFF FL+IYLIGYFIVFRN++ K Sbjct: 1 MEMLLLQQSWLFFPFFIFFLSIYLIGYFIVFRNKNPK 37 >GAU18764.1 hypothetical protein TSUD_80530 [Trifolium subterraneum] Length = 293 Score = 53.9 bits (128), Expect = 1e-05 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +1 Query: 331 MATLVFSEGWIVFPFFFMFLTIYLIGYFIVFRNRSTK 441 M L+ + W+ FPFF FL+IYLIGYFIVFRN++ K Sbjct: 1 MEMLLLQQSWLFFPFFIFFLSIYLIGYFIVFRNKNPK 37