BLASTX nr result
ID: Glycyrrhiza35_contig00015547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015547 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_012753479.1 copper resistance protein B [Methylobacterium ext... 114 1e-28 >WP_012753479.1 copper resistance protein B [Methylobacterium extorquens] ACS44165.1 Copper resistance copB protein (plasmid) [Methylobacterium extorquens AM1] Length = 354 Score = 114 bits (284), Expect = 1e-28 Identities = 59/80 (73%), Positives = 59/80 (73%) Frame = -1 Query: 241 AGMNGDHDMGAMRGTTSSLPRRVGAKRAAPSPAGPLASHNAGTMDGMGGIEXXXXXXXXX 62 AGMNGDHDMGAMRGTTSSLPRRVGAKRAAPSPAGPLASHNAGTMDGMGGIE Sbjct: 51 AGMNGDHDMGAMRGTTSSLPRRVGAKRAAPSPAGPLASHNAGTMDGMGGIEAQREMPNPP 110 Query: 61 XXXXXXXXXXXXADLVYNPS 2 ADLVYNPS Sbjct: 111 PPPAALSGPAHAADLVYNPS 130