BLASTX nr result
ID: Glycyrrhiza35_contig00015485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015485 (574 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010097202.1 hypothetical protein L484_025749 [Morus notabilis... 99 6e-24 XP_016477211.1 PREDICTED: signal recognition particle 54 kDa pro... 96 4e-22 XP_018854479.1 PREDICTED: signal recognition particle 54 kDa pro... 101 8e-22 OAY52792.1 hypothetical protein MANES_04G111700 [Manihot esculenta] 101 8e-22 OAY36897.1 hypothetical protein MANES_11G058200 [Manihot esculenta] 101 8e-22 KJB70637.1 hypothetical protein B456_011G084700 [Gossypium raimo... 100 9e-22 KCW54894.1 hypothetical protein EUGRSUZ_I00867 [Eucalyptus grandis] 95 1e-21 XP_018718643.1 PREDICTED: signal recognition particle 54 kDa pro... 95 2e-21 XP_017978974.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 XP_011073411.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 XP_017649581.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 XP_016678150.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 XP_012455795.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 XP_002517663.1 PREDICTED: signal recognition particle 54 kDa pro... 100 2e-21 KVH98037.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 100 3e-21 XP_010279659.1 PREDICTED: signal recognition particle 54 kDa pro... 100 3e-21 XP_010259930.1 PREDICTED: signal recognition particle 54 kDa pro... 100 3e-21 OIW19219.1 hypothetical protein TanjilG_20344 [Lupinus angustifo... 100 4e-21 XP_002322968.2 Signal recognition particle 54 kDa protein 1 [Pop... 100 4e-21 OMP01402.1 hypothetical protein COLO4_11914 [Corchorus olitorius] 100 4e-21 >XP_010097202.1 hypothetical protein L484_025749 [Morus notabilis] EXB67269.1 hypothetical protein L484_025749 [Morus notabilis] Length = 80 Score = 99.0 bits (245), Expect = 6e-24 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 429 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGG Sbjct: 31 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG 78 >XP_016477211.1 PREDICTED: signal recognition particle 54 kDa protein 1-like [Nicotiana tabacum] Length = 143 Score = 96.3 bits (238), Expect = 4e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQ+MSKVLPPQMLKQIGGMGGLQ+LMKQMGS KDMMGMFGGGE Sbjct: 95 LSRNMNAQNMSKVLPPQMLKQIGGMGGLQSLMKQMGSAKDMMGMFGGGE 143 >XP_018854479.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Juglans regia] XP_018851743.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Juglans regia] XP_018806951.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Juglans regia] Length = 494 Score = 101 bits (252), Expect = 8e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGD 494 >OAY52792.1 hypothetical protein MANES_04G111700 [Manihot esculenta] Length = 495 Score = 101 bits (252), Expect = 8e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGD 494 >OAY36897.1 hypothetical protein MANES_11G058200 [Manihot esculenta] Length = 495 Score = 101 bits (252), Expect = 8e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGD 494 >KJB70637.1 hypothetical protein B456_011G084700 [Gossypium raimondii] Length = 411 Score = 100 bits (250), Expect = 9e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 429 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG Sbjct: 361 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 408 >KCW54894.1 hypothetical protein EUGRSUZ_I00867 [Eucalyptus grandis] Length = 150 Score = 95.1 bits (235), Expect = 1e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 569 SRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 SRNMNAQHMS+VLPPQMLKQI GMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 102 SRNMNAQHMSRVLPPQMLKQISGMGGLQNLMKQMGSGKDMMGMFGGGE 149 >XP_018718643.1 PREDICTED: signal recognition particle 54 kDa protein 3-like isoform X2 [Eucalyptus grandis] Length = 154 Score = 95.1 bits (235), Expect = 2e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 569 SRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 SRNMNAQHMS+VLPPQMLKQI GMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 106 SRNMNAQHMSRVLPPQMLKQISGMGGLQNLMKQMGSGKDMMGMFGGGE 153 >XP_017978974.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Theobroma cacao] EOY25893.1 Signal recognition particle, SRP54 subunit protein [Theobroma cacao] Length = 494 Score = 100 bits (250), Expect = 2e-21 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >XP_011073411.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Sesamum indicum] Length = 495 Score = 100 bits (250), Expect = 2e-21 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >XP_017649581.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Gossypium arboreum] Length = 496 Score = 100 bits (250), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 429 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 493 >XP_016678150.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Gossypium hirsutum] XP_016698438.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Gossypium hirsutum] Length = 496 Score = 100 bits (250), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 429 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 493 >XP_012455795.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Gossypium raimondii] KJB70636.1 hypothetical protein B456_011G084700 [Gossypium raimondii] Length = 496 Score = 100 bits (250), Expect = 2e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 429 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGG 493 >XP_002517663.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ricinus communis] EEF44827.1 signal recognition particle 54 kD protein, putative [Ricinus communis] Length = 497 Score = 100 bits (250), Expect = 2e-21 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >KVH98037.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 495 Score = 100 bits (248), Expect = 3e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494 >XP_010279659.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Nelumbo nucifera] Length = 495 Score = 100 bits (248), Expect = 3e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494 >XP_010259930.1 PREDICTED: signal recognition particle 54 kDa protein 2-like [Nelumbo nucifera] Length = 495 Score = 100 bits (248), Expect = 3e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494 >OIW19219.1 hypothetical protein TanjilG_20344 [Lupinus angustifolius] Length = 483 Score = 99.8 bits (247), Expect = 4e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQ+LMKQMGSTKDMMGMFGGG+ Sbjct: 434 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQSLMKQMGSTKDMMGMFGGGD 482 >XP_002322968.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] EEF04729.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] Length = 493 Score = 99.8 bits (247), Expect = 4e-21 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGG+ Sbjct: 444 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 492 >OMP01402.1 hypothetical protein COLO4_11914 [Corchorus olitorius] Length = 495 Score = 99.8 bits (247), Expect = 4e-21 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -3 Query: 572 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSTKDMMGMFGGGE 426 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494