BLASTX nr result
ID: Glycyrrhiza35_contig00015439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015439 (691 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN39194.1 hypothetical protein glysoja_027999 [Glycine soja] KR... 66 8e-14 BAT74012.1 hypothetical protein VIGAN_01159400 [Vigna angularis ... 75 1e-13 KHN28498.1 hypothetical protein glysoja_049031 [Glycine soja] 57 3e-07 >KHN39194.1 hypothetical protein glysoja_027999 [Glycine soja] KRH42210.1 hypothetical protein GLYMA_08G075800 [Glycine max] Length = 114 Score = 66.2 bits (160), Expect(2) = 8e-14 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +3 Query: 240 VENLQPIVFMHYCSIWWKIALIKPFSCLHVMFCLPRSSLS 359 + N P++F+H CS+WWKIALI+ F+CLHVMFCL RSSLS Sbjct: 73 LSNYDPLLFLHCCSMWWKIALIEHFTCLHVMFCLLRSSLS 112 Score = 38.9 bits (89), Expect(2) = 8e-14 Identities = 25/40 (62%), Positives = 28/40 (70%), Gaps = 2/40 (5%) Frame = +1 Query: 148 ICIPLLFSSLGT--DGRVPFSVIVAHYLEDLDELRICNPL 261 ICIPLLFSS G +G VPFS+IVA L DLD L +PL Sbjct: 41 ICIPLLFSSRGALIEG-VPFSMIVALCLGDLDALSNYDPL 79 >BAT74012.1 hypothetical protein VIGAN_01159400 [Vigna angularis var. angularis] Length = 125 Score = 74.7 bits (182), Expect = 1e-13 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +3 Query: 240 VENLQPIVFMHYCSIWWKIALIKPFSCLHVMFCLPRSSLSCYKTIIKSEFGPKFPFS 410 + N P++F+ CSIWWKIALI+ F+CLHVMFCL RSSLS ++ ++K +F FP S Sbjct: 13 LSNYDPLLFLRCCSIWWKIALIQLFTCLHVMFCLLRSSLSYHRALVKPDFALIFPCS 69 >KHN28498.1 hypothetical protein glysoja_049031 [Glycine soja] Length = 108 Score = 57.4 bits (137), Expect = 3e-07 Identities = 35/84 (41%), Positives = 45/84 (53%), Gaps = 10/84 (11%) Frame = +2 Query: 281 YMVEDCSHQTFFLPACDVLFAEIQFVLL*NDNQI----------*VWSQISILLPQGWAP 430 Y+VEDCSH+T +LPAC+VL+AEIQFVL + S++ L+ P Sbjct: 27 YVVEDCSHRTLYLPACNVLYAEIQFVLTIERGIVKPEFGPKFAFSSTSRLGSLVSDMRLP 86 Query: 431 *YQI*DFATLLNHCTMIMKGNWLC 502 Y LN T +MKGNWLC Sbjct: 87 PY--------LNLLTKVMKGNWLC 102