BLASTX nr result
ID: Glycyrrhiza35_contig00015084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00015084 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48505.1 hypothetical protein TSUD_291910 [Trifolium subterran... 81 8e-18 GAU12324.1 hypothetical protein TSUD_252750 [Trifolium subterran... 70 1e-12 XP_003608261.1 transmembrane protein, putative [Medicago truncat... 52 1e-06 >GAU48505.1 hypothetical protein TSUD_291910 [Trifolium subterraneum] Length = 112 Score = 81.3 bits (199), Expect = 8e-18 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -2 Query: 314 PLRNHFYHFLSDHDQSADCYWLRLDVFIATGIMWFTSLDPSLSFTFEYLN 165 PLRNHF HFLSDHD+SADCYWLRLDVFIATGIMWFT + F + N Sbjct: 15 PLRNHFDHFLSDHDRSADCYWLRLDVFIATGIMWFTREGRKIIVAFPFPN 64 >GAU12324.1 hypothetical protein TSUD_252750 [Trifolium subterraneum] Length = 207 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 293 HFLSDHDQSADCYWLRLDVFIATGIMWFTSL 201 HFLSDHD+SADCYWLRLDVFIATGIMWFTSL Sbjct: 100 HFLSDHDRSADCYWLRLDVFIATGIMWFTSL 130 >XP_003608261.1 transmembrane protein, putative [Medicago truncatula] AES90458.1 transmembrane protein, putative [Medicago truncatula] Length = 77 Score = 52.0 bits (123), Expect = 1e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 283 QTMTRVLIAIGFGWMCSSPLASCG 212 QTMT VLIAIGFGWMCSSPLASCG Sbjct: 31 QTMTGVLIAIGFGWMCSSPLASCG 54