BLASTX nr result
ID: Glycyrrhiza35_contig00014820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00014820 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG46125.1 hypothetical protein CL1001Contig2_03, partial [Pinus... 90 9e-22 AFG51276.1 hypothetical protein CL1001Contig1_01, partial [Pinus... 90 2e-21 XP_018835389.1 PREDICTED: DNA topoisomerase 6 subunit A [Juglans... 97 2e-21 XP_016176761.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Ar... 96 4e-21 XP_016170733.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Ar... 96 4e-21 XP_015937296.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Ar... 96 4e-21 XP_017407075.1 PREDICTED: DNA topoisomerase 6 subunit A [Vigna a... 96 4e-21 KHN48335.1 DNA topoisomerase 6 subunit A [Glycine soja] 96 4e-21 XP_007144519.1 hypothetical protein PHAVU_007G162700g [Phaseolus... 96 4e-21 XP_003542493.1 PREDICTED: DNA topoisomerase 6 subunit A [Glycine... 96 4e-21 XP_014502545.1 PREDICTED: DNA topoisomerase 6 subunit A [Vigna r... 96 4e-21 XP_003537243.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Gl... 96 4e-21 XP_019462170.1 PREDICTED: DNA topoisomerase 6 subunit A [Lupinus... 96 4e-21 AID62216.1 DNA topoisomerase VI subunit A [Lotus japonicus] 96 4e-21 AEW08636.1 hypothetical protein CL1001Contig2_03, partial [Pinus... 88 5e-21 XP_004497452.1 PREDICTED: DNA topoisomerase 6 subunit A [Cicer a... 96 6e-21 XP_013468261.1 SPO11/DNA topoisomerase VI, subunit A [Medicago t... 96 7e-21 KOM26971.1 hypothetical protein LR48_Vigan347s002500 [Vigna angu... 96 7e-21 AEW08635.1 hypothetical protein CL1001Contig1_01, partial [Pinus... 88 9e-21 KYP36459.1 DNA topoisomerase 6 subunit A [Cajanus cajan] 94 1e-20 >AFG46125.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] Length = 52 Score = 89.7 bits (221), Expect = 9e-22 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 +PGWV+EL LMVKTKQKAEIQALS+FGFQYLSEVYLPLKLQQRDW+ Sbjct: 7 SPGWVDELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQRDWI 52 >AFG51276.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] Length = 75 Score = 89.7 bits (221), Expect = 2e-21 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 +PGWV+EL LMVKTKQKAEIQALS+FGFQYLSEVYLPLKLQQRDW+ Sbjct: 30 SPGWVDELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQRDWI 75 >XP_018835389.1 PREDICTED: DNA topoisomerase 6 subunit A [Juglans regia] Length = 422 Score = 97.1 bits (240), Expect = 2e-21 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL Sbjct: 377 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 422 >XP_016176761.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Arachis ipaensis] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_016170733.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Arachis ipaensis] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_015937296.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Arachis duranensis] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_017407075.1 PREDICTED: DNA topoisomerase 6 subunit A [Vigna angularis] BAT95828.1 hypothetical protein VIGAN_08263800 [Vigna angularis var. angularis] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >KHN48335.1 DNA topoisomerase 6 subunit A [Glycine soja] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_007144519.1 hypothetical protein PHAVU_007G162700g [Phaseolus vulgaris] ESW16513.1 hypothetical protein PHAVU_007G162700g [Phaseolus vulgaris] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_003542493.1 PREDICTED: DNA topoisomerase 6 subunit A [Glycine max] KRH19789.1 hypothetical protein GLYMA_13G136100 [Glycine max] Length = 417 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >XP_014502545.1 PREDICTED: DNA topoisomerase 6 subunit A [Vigna radiata var. radiata] Length = 418 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 373 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 418 >XP_003537243.1 PREDICTED: DNA topoisomerase 6 subunit A-like [Glycine max] KHN39117.1 DNA topoisomerase 6 subunit A [Glycine soja] KRH32381.1 hypothetical protein GLYMA_10G048300 [Glycine max] Length = 419 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 374 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 419 >XP_019462170.1 PREDICTED: DNA topoisomerase 6 subunit A [Lupinus angustifolius] OIW01634.1 hypothetical protein TanjilG_14633 [Lupinus angustifolius] Length = 422 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 377 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 422 >AID62216.1 DNA topoisomerase VI subunit A [Lotus japonicus] Length = 422 Score = 95.9 bits (237), Expect = 4e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 377 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 422 >AEW08636.1 hypothetical protein CL1001Contig2_03, partial [Pinus radiata] AFG46111.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46112.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46113.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46114.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46115.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46116.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46117.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46118.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46119.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46120.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46121.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46122.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46123.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46124.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46126.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46127.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] AFG46128.1 hypothetical protein CL1001Contig2_03, partial [Pinus taeda] Length = 52 Score = 87.8 bits (216), Expect = 5e-21 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 +PGWV+EL LMVKTK KAEIQALS+FGFQYLSEVYLPLKLQQRDW+ Sbjct: 7 SPGWVDELNLMVKTKHKAEIQALSSFGFQYLSEVYLPLKLQQRDWI 52 >XP_004497452.1 PREDICTED: DNA topoisomerase 6 subunit A [Cicer arietinum] Length = 417 Score = 95.5 bits (236), Expect = 6e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQQDWL 417 >XP_013468261.1 SPO11/DNA topoisomerase VI, subunit A [Medicago truncatula] KEH42298.1 SPO11/DNA topoisomerase VI, subunit A [Medicago truncatula] Length = 443 Score = 95.5 bits (236), Expect = 7e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 372 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQQDWL 417 >KOM26971.1 hypothetical protein LR48_Vigan347s002500 [Vigna angularis] Length = 769 Score = 95.9 bits (237), Expect = 7e-21 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 724 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 769 >AEW08635.1 hypothetical protein CL1001Contig1_01, partial [Pinus radiata] AFG51272.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51273.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51274.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51275.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51277.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51278.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51279.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51280.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51281.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51282.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51283.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51284.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51285.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51286.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51287.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] AFG51288.1 hypothetical protein CL1001Contig1_01, partial [Pinus taeda] Length = 75 Score = 87.8 bits (216), Expect = 9e-21 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 +PGWV+EL LMVKTK KAEIQALS+FGFQYLSEVYLPLKLQQRDW+ Sbjct: 30 SPGWVDELNLMVKTKHKAEIQALSSFGFQYLSEVYLPLKLQQRDWI 75 >KYP36459.1 DNA topoisomerase 6 subunit A [Cajanus cajan] Length = 418 Score = 94.4 bits (233), Expect = 1e-20 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -1 Query: 324 NPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQRDWL 187 NPGWVEEL+LMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQ+DWL Sbjct: 373 NPGWVEELSLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 418