BLASTX nr result
ID: Glycyrrhiza35_contig00014324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00014324 (565 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007157751.1 hypothetical protein PHAVU_002G095500g [Phaseolus... 56 2e-06 KHN16976.1 hypothetical protein glysoja_035827 [Glycine soja] 52 6e-06 >XP_007157751.1 hypothetical protein PHAVU_002G095500g [Phaseolus vulgaris] ESW29745.1 hypothetical protein PHAVU_002G095500g [Phaseolus vulgaris] Length = 204 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -1 Query: 517 PATAGGSETKILESFDAPPVPNFEYK 440 PAT+GGSETK+LESFDAPPVPNFEYK Sbjct: 179 PATSGGSETKVLESFDAPPVPNFEYK 204 >KHN16976.1 hypothetical protein glysoja_035827 [Glycine soja] Length = 56 Score = 51.6 bits (122), Expect = 6e-06 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -1 Query: 565 KSWLXXXXXXXXXXXEPATAG-GSETKILESFDAPPVPNFEYK 440 +SWL TAG GSETKILESFDAPPVPNFEYK Sbjct: 14 QSWLGGWFGGGNKEETATTAGSGSETKILESFDAPPVPNFEYK 56