BLASTX nr result
ID: Glycyrrhiza35_contig00013787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00013787 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK44533.1 unknown [Lotus japonicus] 92 3e-22 OAY75244.1 GTP-binding protein SAR1A, partial [Ananas comosus] 90 9e-22 KDO87024.1 hypothetical protein CISIN_1g0294371mg, partial [Citr... 90 9e-22 XP_019441202.1 PREDICTED: GTP-binding protein SAR1B [Lupinus ang... 92 1e-21 GAU11442.1 hypothetical protein TSUD_344330 [Trifolium subterran... 92 1e-21 KYP71291.1 GTP-binding protein SAR1A [Cajanus cajan] 92 1e-21 XP_013450457.1 Ras-related small GTP-binding family protein [Med... 92 1e-21 XP_004494541.1 PREDICTED: GTP-binding protein SAR1A-like [Cicer ... 92 1e-21 AFK44051.1 unknown [Medicago truncatula] 92 1e-21 NP_001238537.1 uncharacterized protein LOC100305650 [Glycine max... 92 1e-21 XP_003536048.1 PREDICTED: GTP-binding protein SAR1A [Glycine max... 92 2e-21 XP_010096809.1 GTP-binding protein [Morus notabilis] EXB66050.1 ... 90 3e-21 XP_019422685.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinu... 91 3e-21 XP_019420080.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinu... 91 3e-21 KHN43341.1 GTP-binding protein SAR1A [Glycine soja] KRG96730.1 h... 91 3e-21 NP_001238260.1 uncharacterized protein LOC100305632 [Glycine max... 91 3e-21 XP_018846147.1 PREDICTED: GTP-binding protein SAR1A isoform X2 [... 90 4e-21 KJB24406.1 hypothetical protein B456_004G144100 [Gossypium raimo... 89 5e-21 XP_019706124.1 PREDICTED: GTP-binding protein SAR1A, partial [El... 89 5e-21 NP_001318907.1 Ras-related small GTP-binding family protein [Ara... 89 6e-21 >AFK44533.1 unknown [Lotus japonicus] Length = 149 Score = 92.4 bits (228), Expect = 3e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 107 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 149 >OAY75244.1 GTP-binding protein SAR1A, partial [Ananas comosus] Length = 106 Score = 90.1 bits (222), Expect = 9e-22 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 64 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 106 >KDO87024.1 hypothetical protein CISIN_1g0294371mg, partial [Citrus sinensis] Length = 106 Score = 90.1 bits (222), Expect = 9e-22 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 64 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 106 >XP_019441202.1 PREDICTED: GTP-binding protein SAR1B [Lupinus angustifolius] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 193 >GAU11442.1 hypothetical protein TSUD_344330 [Trifolium subterraneum] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >KYP71291.1 GTP-binding protein SAR1A [Cajanus cajan] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK Sbjct: 151 FTTGKGKVNLADSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 193 >XP_013450457.1 Ras-related small GTP-binding family protein [Medicago truncatula] KEH24485.1 Ras-related small GTP-binding family protein [Medicago truncatula] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >XP_004494541.1 PREDICTED: GTP-binding protein SAR1A-like [Cicer arietinum] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >AFK44051.1 unknown [Medicago truncatula] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >NP_001238537.1 uncharacterized protein LOC100305650 [Glycine max] ACU13443.1 unknown [Glycine max] KHN03937.1 GTP-binding protein SAR1A [Glycine soja] KRH68445.1 hypothetical protein GLYMA_03G231800 [Glycine max] KRH68446.1 hypothetical protein GLYMA_03G231800 [Glycine max] Length = 193 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >XP_003536048.1 PREDICTED: GTP-binding protein SAR1A [Glycine max] KHN16069.1 GTP-binding protein SAR1A [Glycine soja] KRH33832.1 hypothetical protein GLYMA_10G147800 [Glycine max] Length = 193 Score = 91.7 bits (226), Expect = 2e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKG VNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK Sbjct: 151 FTTGKGNVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 193 >XP_010096809.1 GTP-binding protein [Morus notabilis] EXB66050.1 GTP-binding protein [Morus notabilis] Length = 149 Score = 90.1 bits (222), Expect = 3e-21 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 107 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 149 >XP_019422685.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinus angustifolius] OIW17475.1 hypothetical protein TanjilG_22587 [Lupinus angustifolius] Length = 193 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRPMEVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 151 FTTGKGKVNLADSNVRPMEVFMCSIVRKMGYGDGFKWLSQYIK 193 >XP_019420080.1 PREDICTED: GTP-binding protein SAR1A-like [Lupinus angustifolius] OIV95257.1 hypothetical protein TanjilG_26954 [Lupinus angustifolius] Length = 193 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNLSDSNVRPMEV+MCSIV+KMGYGDGFKWLSQYIK Sbjct: 151 FTTGKGKVNLSDSNVRPMEVYMCSIVRKMGYGDGFKWLSQYIK 193 >KHN43341.1 GTP-binding protein SAR1A [Glycine soja] KRG96730.1 hypothetical protein GLYMA_19G228800 [Glycine max] Length = 193 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLADSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >NP_001238260.1 uncharacterized protein LOC100305632 [Glycine max] ACU13416.1 unknown [Glycine max] Length = 193 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRPMEVFMCSIVKKMGYGDGFKW+SQYIK Sbjct: 151 FTTGKGKVNLADSNVRPMEVFMCSIVKKMGYGDGFKWVSQYIK 193 >XP_018846147.1 PREDICTED: GTP-binding protein SAR1A isoform X2 [Juglans regia] Length = 165 Score = 90.1 bits (222), Expect = 4e-21 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYGDGFKWLSQYIK Sbjct: 123 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 165 >KJB24406.1 hypothetical protein B456_004G144100 [Gossypium raimondii] Length = 147 Score = 89.4 bits (220), Expect = 5e-21 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYGDGFKW+SQYIK Sbjct: 105 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYIK 147 >XP_019706124.1 PREDICTED: GTP-binding protein SAR1A, partial [Elaeis guineensis] Length = 121 Score = 88.6 bits (218), Expect = 5e-21 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYG+GFKWLSQYIK Sbjct: 79 FTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 121 >NP_001318907.1 Ras-related small GTP-binding family protein [Arabidopsis thaliana] AEE27450.1 Ras-related small GTP-binding family protein [Arabidopsis thaliana] Length = 122 Score = 88.6 bits (218), Expect = 6e-21 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 240 FTTGKGKVNLSDSNVRPMEVFMCSIVKKMGYGDGFKWLSQYIK 112 FTTGKGKVNL+DSNVRP+EVFMCSIV+KMGYG+GFKWLSQYIK Sbjct: 80 FTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 122