BLASTX nr result
ID: Glycyrrhiza35_contig00013758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00013758 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004495385.1 PREDICTED: PRA1 family protein D-like [Cicer arie... 54 5e-06 GAU25835.1 hypothetical protein TSUD_30990 [Trifolium subterraneum] 54 9e-06 XP_003591796.2 PRA1 family protein [Medicago truncatula] AFK3539... 54 9e-06 >XP_004495385.1 PREDICTED: PRA1 family protein D-like [Cicer arietinum] Length = 179 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -1 Query: 360 CLHGAFRRTDEGVVDDYESPYGPMLNDTNTAAGPYTRV 247 CLHG RRTDE +DDYESPYGPML D AGPY V Sbjct: 146 CLHGGLRRTDEVGLDDYESPYGPMLTD----AGPYAPV 179 >GAU25835.1 hypothetical protein TSUD_30990 [Trifolium subterraneum] Length = 181 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -1 Query: 360 CLHGAFRRTDEGVVDDYESPYGPMLNDTNTAAGPYTRV 247 CLHGA R TD G +DDYESPYGPMLN+ +AG Y+ V Sbjct: 146 CLHGALRTTDVGGLDDYESPYGPMLNE--ASAGSYSPV 181 >XP_003591796.2 PRA1 family protein [Medicago truncatula] AFK35395.1 unknown [Medicago truncatula] AES62047.2 PRA1 family protein [Medicago truncatula] Length = 181 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -1 Query: 360 CLHGAFRRTDEGVVDDYESPYGPMLNDTNTAAGPYTRV 247 CLHGA +RTD G +DDYESPYGPML AGPY V Sbjct: 146 CLHGALKRTDVGGLDDYESPYGPML--ATDTAGPYAPV 181