BLASTX nr result
ID: Glycyrrhiza35_contig00013680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00013680 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora... 59 2e-09 XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora... 57 1e-08 XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora... 57 1e-08 XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora... 57 1e-08 XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora... 57 2e-08 XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora... 56 4e-08 XP_007413084.1 hypothetical protein MELLADRAFT_90062 [Melampsora... 56 2e-07 XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora... 53 4e-07 XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora... 49 3e-06 XP_007418756.1 hypothetical protein MELLADRAFT_84126 [Melampsora... 52 1e-05 >XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] EGF97270.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] Length = 98 Score = 59.3 bits (142), Expect = 2e-09 Identities = 41/95 (43%), Positives = 51/95 (53%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + I VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKINK-VEQIFRTRDEPQQIVATRLLYCLQYPAVIQVVCKGFTPAHIFNTICN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S + Y GSQA ALF+HN Q H Sbjct: 62 FMHQVFPLSTQSIAYNGSQAYALFRHNGKCAGQGH 96 >XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] EGF99323.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] Length = 97 Score = 57.4 bits (137), Expect = 1e-08 Identities = 40/95 (42%), Positives = 50/95 (52%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 2 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 60 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S + Y GSQA ALF+HN Q H Sbjct: 61 FMHQVFPLSTQSIAYNGSQAYALFRHNGKCAGQGH 95 >XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] EGF99027.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.4 bits (137), Expect = 1e-08 Identities = 40/95 (42%), Positives = 50/95 (52%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S + Y GSQA ALF+HN Q H Sbjct: 62 FMHQVFPLSTQSITYNGSQAYALFRHNGKCAGQGH 96 >XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] XP_007411657.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] XP_007413078.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] XP_007413995.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] XP_007414496.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] XP_007414630.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] XP_007415541.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] XP_007417444.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] XP_007418188.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] XP_007419025.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF97702.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF98537.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] EGF99310.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] EGG01191.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] EGG02093.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] EGG02239.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] EGG02882.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] EGG03631.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] EGG05292.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] EGG06255.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.4 bits (137), Expect = 1e-08 Identities = 40/95 (42%), Positives = 50/95 (52%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S + Y GSQA ALF+HN Q H Sbjct: 62 FMHQVFPLSTQSIAYNGSQAYALFRHNGKCAGQGH 96 >XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] XP_007419047.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGF97685.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGG05065.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] Length = 98 Score = 56.6 bits (135), Expect = 2e-08 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S Y GSQA ALF+HN Q H Sbjct: 62 FMHQVFPLSTQLIAYNGSQAYALFRHNGKCAGQGH 96 >XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] EGG00440.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] Length = 98 Score = 55.8 bits (133), Expect = 4e-08 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 1/95 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTTCN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN*HVRDQHH 5 + F S Y GSQA ALF+HN Q H Sbjct: 62 FMHQVFPLSTQLIAYNGSQAYALFRHNGKCAGQGH 96 >XP_007413084.1 hypothetical protein MELLADRAFT_90062 [Melampsora larici-populina 98AG31] XP_007413088.1 hypothetical protein MELLADRAFT_90068 [Melampsora larici-populina 98AG31] EGG03637.1 hypothetical protein MELLADRAFT_90062 [Melampsora larici-populina 98AG31] EGG03641.1 hypothetical protein MELLADRAFT_90068 [Melampsora larici-populina 98AG31] Length = 217 Score = 56.2 bits (134), Expect = 2e-07 Identities = 38/87 (43%), Positives = 48/87 (55%), Gaps = 1/87 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ + K P + Sbjct: 2 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 60 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN 29 + F S + Y GSQA ALF+HN Sbjct: 61 FMHQVFPLSTQSIAYNGSQAYALFRHN 87 >XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] EGF98954.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] Length = 97 Score = 53.1 bits (126), Expect = 4e-07 Identities = 37/82 (45%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = -3 Query: 247 VEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFISEQQRPFRPSY*AN 68 VEQI+RTR PQQIVATRLLYCLQ+ + K P + + F S + Sbjct: 14 VEQIFRTRDEPQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICNFMHQVFPLSTQSI 73 Query: 67 IY-GSQAEALFKHN*HVRDQHH 5 Y GSQA ALF+HN Q H Sbjct: 74 AYNGSQAYALFRHNGKCAGQGH 95 >XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] EGG09856.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] Length = 85 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQH 173 CK+ K+ + VEQI+RTR PQQIVATRLLYCLQ+ Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEPQQIVATRLLYCLQY 39 Score = 29.6 bits (65), Expect(2) = 3e-06 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 158 VVCKGFTPAHI*ISIHQRATKTFP 87 VVCKGFTPAHI +I + FP Sbjct: 45 VVCKGFTPAHIFNTICNFMHQVFP 68 >XP_007418756.1 hypothetical protein MELLADRAFT_84126 [Melampsora larici-populina 98AG31] EGF97977.1 hypothetical protein MELLADRAFT_84126 [Melampsora larici-populina 98AG31] Length = 213 Score = 51.6 bits (122), Expect = 1e-05 Identities = 36/87 (41%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Frame = -3 Query: 286 CKEKKKKRSIQHGVEQIYRTRA*PQQIVATRLLYCLQHSVPNKSSAKDSPPPISKFQFIS 107 CK+ K+ + VEQI+RTR QQIVATRLLYCLQ+ + K P + Sbjct: 3 CKKSKRSKKFNK-VEQIFRTRDEAQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICN 61 Query: 106 EQQRPFRPSY*ANIY-GSQAEALFKHN 29 + F S + Y GSQA LF+HN Sbjct: 62 FMHQVFPLSTQSIAYNGSQAYTLFRHN 88