BLASTX nr result
ID: Glycyrrhiza35_contig00013649
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00013649 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012574171.1 PREDICTED: protein PAIR1-like [Cicer arietinum] 58 1e-07 GAU44027.1 hypothetical protein TSUD_349590 [Trifolium subterran... 59 1e-07 XP_003627577.2 PAIR1, putative [Medicago truncatula] AET02053.2 ... 57 6e-07 KYP77082.1 Protein PAIR1 [Cajanus cajan] 55 2e-06 >XP_012574171.1 PREDICTED: protein PAIR1-like [Cicer arietinum] Length = 255 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 136 KMKINKASDLSSISVFPPPHVYSRRPNTVSSGL 234 KMKINKA DLSSISVFPPPH Y+RRPN S GL Sbjct: 2 KMKINKACDLSSISVFPPPHGYARRPNNASMGL 34 >GAU44027.1 hypothetical protein TSUD_349590 [Trifolium subterraneum] Length = 456 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 139 MKINKASDLSSISVFPPPHVYSRRPNTVSSGL 234 MKINKA+DLSSISVFPPPH+YSR+ N VS+GL Sbjct: 1 MKINKAADLSSISVFPPPHIYSRKTNNVSNGL 32 >XP_003627577.2 PAIR1, putative [Medicago truncatula] AET02053.2 PAIR1, putative [Medicago truncatula] Length = 457 Score = 56.6 bits (135), Expect = 6e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 139 MKINKASDLSSISVFPPPHVYSRRPNTVSSG 231 MKINKASDLSSISVFPPPHVYSR+ N S+G Sbjct: 1 MKINKASDLSSISVFPPPHVYSRKMNNASNG 31 >KYP77082.1 Protein PAIR1 [Cajanus cajan] Length = 258 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 136 KMKINKASDLSSISVFPPPHVYSRRPNTVSSGL 234 KMKINKA DLSSISVFPPP VY R+ N VSSGL Sbjct: 2 KMKINKACDLSSISVFPPPLVYPRKGNNVSSGL 34