BLASTX nr result
ID: Glycyrrhiza35_contig00013050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00013050 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP74111.1 hypothetical protein KK1_006779 [Cajanus cajan] 119 3e-30 KOM35259.1 hypothetical protein LR48_Vigan02g140900 [Vigna angul... 118 8e-30 XP_017412451.1 PREDICTED: arginine biosynthesis bifunctional pro... 118 8e-30 XP_007144460.1 hypothetical protein PHAVU_007G158000g, partial [... 118 1e-29 KHN48990.1 Arginine biosynthesis bifunctional protein ArgJ, chlo... 117 2e-29 XP_003542466.1 PREDICTED: arginine biosynthesis bifunctional pro... 117 2e-29 XP_014512517.1 PREDICTED: arginine biosynthesis bifunctional pro... 116 4e-29 XP_006588728.1 PREDICTED: arginine biosynthesis bifunctional pro... 115 1e-28 KHN05924.1 Arginine biosynthesis bifunctional protein ArgJ, chlo... 115 1e-28 XP_003537190.1 PREDICTED: arginine biosynthesis bifunctional pro... 115 1e-28 AFK43452.1 unknown [Lotus japonicus] 110 1e-28 XP_019440953.1 PREDICTED: arginine biosynthesis bifunctional pro... 112 1e-27 XP_019440952.1 PREDICTED: arginine biosynthesis bifunctional pro... 112 1e-27 XP_013468329.1 arginine biosynthesis protein ArgJ [Medicago trun... 110 9e-27 GAU48080.1 hypothetical protein TSUD_81400 [Trifolium subterraneum] 110 9e-27 XP_004495013.1 PREDICTED: arginine biosynthesis bifunctional pro... 107 1e-25 XP_010088057.1 Arginine biosynthesis bifunctional protein ArgJ [... 105 3e-25 ONI03313.1 hypothetical protein PRUPE_6G250400 [Prunus persica] 102 1e-24 XP_004137760.1 PREDICTED: arginine biosynthesis bifunctional pro... 103 1e-24 XP_009377088.1 PREDICTED: arginine biosynthesis bifunctional pro... 103 2e-24 >KYP74111.1 hypothetical protein KK1_006779 [Cajanus cajan] Length = 442 Score = 119 bits (297), Expect = 3e-30 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR+AASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 386 EPQLFDRNAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 442 >KOM35259.1 hypothetical protein LR48_Vigan02g140900 [Vigna angularis] Length = 454 Score = 118 bits (295), Expect = 8e-30 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 398 EPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 454 >XP_017412451.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Vigna angularis] BAT95381.1 hypothetical protein VIGAN_08209200 [Vigna angularis var. angularis] Length = 464 Score = 118 bits (295), Expect = 8e-30 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 408 EPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 464 >XP_007144460.1 hypothetical protein PHAVU_007G158000g, partial [Phaseolus vulgaris] ESW16454.1 hypothetical protein PHAVU_007G158000g, partial [Phaseolus vulgaris] Length = 506 Score = 118 bits (295), Expect = 1e-29 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 450 EPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 506 >KHN48990.1 Arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Glycine soja] Length = 462 Score = 117 bits (292), Expect = 2e-29 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGETHDTV+IQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 406 EPQLFDRHAASSYLRKAGETHDTVKIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 462 >XP_003542466.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Glycine max] KRH19717.1 hypothetical protein GLYMA_13G131900 [Glycine max] Length = 464 Score = 117 bits (292), Expect = 2e-29 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGETHDTV+IQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 408 EPQLFDRHAASSYLRKAGETHDTVKIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 464 >XP_014512517.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Vigna radiata var. radiata] Length = 464 Score = 116 bits (290), Expect = 4e-29 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AASSYLRKAGE HDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 408 EPQLFDRHAASSYLRKAGEAHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTT 464 >XP_006588728.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Glycine max] Length = 455 Score = 115 bits (287), Expect = 1e-28 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDRD ASSYLR+AGETHDTVRIQISVGNGPG GQAWGCDLSYDYVKINAEYT+ Sbjct: 399 EPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPGCGQAWGCDLSYDYVKINAEYTT 455 >KHN05924.1 Arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Glycine soja] Length = 458 Score = 115 bits (287), Expect = 1e-28 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDRD ASSYLR+AGETHDTVRIQISVGNGPG GQAWGCDLSYDYVKINAEYT+ Sbjct: 402 EPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPGCGQAWGCDLSYDYVKINAEYTT 458 >XP_003537190.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Glycine max] KRH32314.1 hypothetical protein GLYMA_10G044300 [Glycine max] Length = 460 Score = 115 bits (287), Expect = 1e-28 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDRD ASSYLR+AGETHDTVRIQISVGNGPG GQAWGCDLSYDYVKINAEYT+ Sbjct: 404 EPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPGCGQAWGCDLSYDYVKINAEYTT 460 >AFK43452.1 unknown [Lotus japonicus] Length = 233 Score = 110 bits (276), Expect = 1e-28 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDRDAASSYL++AGE+H TVRIQISVGNGPG GQAWGCDLSYDYVKINAEYTS Sbjct: 177 EPQSFDRDAASSYLKRAGESHGTVRIQISVGNGPGSGQAWGCDLSYDYVKINAEYTS 233 >XP_019440953.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Lupinus angustifolius] Length = 443 Score = 112 bits (280), Expect = 1e-27 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR AAS+YLRKAG+THDTVRIQIS+GNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 387 EPQSFDRVAASNYLRKAGDTHDTVRIQISIGNGPGRGQAWGCDLSYDYVKINAEYTT 443 >XP_019440952.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Lupinus angustifolius] Length = 472 Score = 112 bits (280), Expect = 1e-27 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR AAS+YLRKAG+THDTVRIQIS+GNGPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 416 EPQSFDRVAASNYLRKAGDTHDTVRIQISIGNGPGRGQAWGCDLSYDYVKINAEYTT 472 >XP_013468329.1 arginine biosynthesis protein ArgJ [Medicago truncatula] KEH42366.1 arginine biosynthesis protein ArgJ [Medicago truncatula] Length = 470 Score = 110 bits (274), Expect = 9e-27 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR ASSYLRKAGETH TVRIQIS+GNGPG GQAWGCDLSYDYVKINAEYTS Sbjct: 414 EPQSFDRGEASSYLRKAGETHGTVRIQISIGNGPGHGQAWGCDLSYDYVKINAEYTS 470 >GAU48080.1 hypothetical protein TSUD_81400 [Trifolium subterraneum] Length = 473 Score = 110 bits (274), Expect = 9e-27 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR AASSYLRKAGETH TVRIQIS+G+GPG GQAWGCDLSYDYVKINAEYTS Sbjct: 417 EPQSFDRGAASSYLRKAGETHGTVRIQISIGDGPGHGQAWGCDLSYDYVKINAEYTS 473 >XP_004495013.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Cicer arietinum] Length = 467 Score = 107 bits (266), Expect = 1e-25 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR ASSYLR AGETH TV+IQIS+GNGPG+GQAWGCDLSYDYVKINAEYTS Sbjct: 411 EPQSFDRGEASSYLRTAGETHGTVKIQISIGNGPGQGQAWGCDLSYDYVKINAEYTS 467 >XP_010088057.1 Arginine biosynthesis bifunctional protein ArgJ [Morus notabilis] EXB31276.1 Arginine biosynthesis bifunctional protein ArgJ [Morus notabilis] Length = 382 Score = 105 bits (261), Expect = 3e-25 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AAS+YL+K+GETH TV I++SVG+GPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 326 EPQLFDRAAASAYLKKSGETHGTVDIKVSVGDGPGRGQAWGCDLSYDYVKINAEYTT 382 >ONI03313.1 hypothetical protein PRUPE_6G250400 [Prunus persica] Length = 348 Score = 102 bits (255), Expect = 1e-24 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AAS YL+KAGE H TV I +SVG+GPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 292 EPQLFDRRAASDYLKKAGEIHGTVVINVSVGDGPGRGQAWGCDLSYDYVKINAEYTT 348 >XP_004137760.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Cucumis sativus] KGN58890.1 hypothetical protein Csa_3G734910 [Cucumis sativus] Length = 460 Score = 103 bits (258), Expect = 1e-24 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQ FDR AAS+YLR+AGETHDTVRI IS+GNG G G+AWGCDLSYDYVKINAEYT+ Sbjct: 404 EPQSFDRAAASNYLRRAGETHDTVRIYISIGNGQGEGRAWGCDLSYDYVKINAEYTT 460 >XP_009377088.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Pyrus x bretschneideri] Length = 462 Score = 103 bits (257), Expect = 2e-24 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 217 EPQLFDRDAASSYLRKAGETHDTVRIQISVGNGPGRGQAWGCDLSYDYVKINAEYTS 47 EPQLFDR AAS YL+KAGE H TV I +SVG+GPGRGQAWGCDLSYDYVKINAEYT+ Sbjct: 406 EPQLFDRSAASDYLKKAGEIHGTVVISVSVGDGPGRGQAWGCDLSYDYVKINAEYTT 462