BLASTX nr result
ID: Glycyrrhiza35_contig00012295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00012295 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN03811.1 Non-specific lipid-transfer protein-like protein [Gly... 64 3e-10 NP_001238368.1 uncharacterized protein LOC100306151 precursor [G... 64 3e-10 XP_014513093.1 PREDICTED: non-specific lipid-transfer protein-li... 55 8e-07 XP_007144649.1 hypothetical protein PHAVU_007G173500g [Phaseolus... 53 4e-06 >KHN03811.1 Non-specific lipid-transfer protein-like protein [Glycine soja] KRH32036.1 hypothetical protein GLYMA_10G028100 [Glycine max] Length = 186 Score = 63.9 bits (154), Expect = 3e-10 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = -3 Query: 328 SITPPALDFPSGAGSKSVPXXXXXXXXXXTIKVPFHLVLYLLAIVSSVTKF 176 SITP ALDFPSGAGSK+VP IKVPFHLVLYLLA+VS F Sbjct: 133 SITPSALDFPSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTF 183 >NP_001238368.1 uncharacterized protein LOC100306151 precursor [Glycine max] ACU14191.1 unknown [Glycine max] Length = 186 Score = 63.9 bits (154), Expect = 3e-10 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = -3 Query: 328 SITPPALDFPSGAGSKSVPXXXXXXXXXXTIKVPFHLVLYLLAIVSSVTKF 176 SITP ALDFPSGAGSK+VP IKVPFHLVLYLLA+VS F Sbjct: 133 SITPSALDFPSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTF 183 >XP_014513093.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Vigna radiata var. radiata] Length = 186 Score = 54.7 bits (130), Expect = 8e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -3 Query: 328 SITPPALDFPSGAGSKSVPXXXXXXXXXXTIKVPFHLVLYLLAIVSSVTKF 176 SI+P A DFPSGAGSK+VP ++VP HLV YL+AIVS V F Sbjct: 133 SISPSASDFPSGAGSKTVPSTDGGSSDGNAVEVPSHLVFYLIAIVSFVLTF 183 >XP_007144649.1 hypothetical protein PHAVU_007G173500g [Phaseolus vulgaris] ESW16643.1 hypothetical protein PHAVU_007G173500g [Phaseolus vulgaris] Length = 186 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = -3 Query: 328 SITPPALDFPSGAGSKSVPXXXXXXXXXXTIKVPFHLVLYLLAIVSSVTKF 176 S +P A DFPSGAGSK+VP I+VP HLV YLLAIVS F Sbjct: 133 STSPSASDFPSGAGSKTVPSTNGGSSDGNAIEVPSHLVFYLLAIVSCALTF 183