BLASTX nr result
ID: Glycyrrhiza35_contig00012246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00012246 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014626982.1 PREDICTED: ATP-citrate synthase alpha chain prote... 77 2e-15 XP_016205627.1 PREDICTED: ATP-citrate synthase alpha chain prote... 80 2e-15 KRH68404.1 hypothetical protein GLYMA_03G228900 [Glycine max] 79 4e-15 KHN43368.1 ATP-citrate synthase alpha chain protein 3 [Glycine s... 77 5e-15 XP_003521649.1 PREDICTED: ATP-citrate synthase alpha chain prote... 79 6e-15 XP_006577202.1 PREDICTED: ATP-citrate synthase alpha chain prote... 79 6e-15 XP_015968711.1 PREDICTED: ATP-citrate synthase alpha chain prote... 78 8e-15 XP_007163298.1 hypothetical protein PHAVU_001G222900g [Phaseolus... 77 2e-14 KYP71605.1 ATP-citrate synthase [Cajanus cajan] 77 2e-14 XP_017416020.1 PREDICTED: LOW QUALITY PROTEIN: ATP-citrate synth... 77 2e-14 XP_014496356.1 PREDICTED: ATP-citrate synthase alpha chain prote... 77 2e-14 KOM39300.1 hypothetical protein LR48_Vigan03g268200 [Vigna angul... 77 2e-14 KJB45487.1 hypothetical protein B456_007G308700 [Gossypium raimo... 75 4e-14 XP_003579058.1 PREDICTED: ATP-citrate synthase alpha chain prote... 76 4e-14 KJB45489.1 hypothetical protein B456_007G308700 [Gossypium raimo... 75 7e-14 XP_012434311.1 PREDICTED: ATP-citrate synthase alpha chain prote... 75 7e-14 KJB45486.1 hypothetical protein B456_007G308700 [Gossypium raimo... 75 7e-14 XP_008360239.2 PREDICTED: ATP-citrate synthase alpha chain prote... 72 8e-14 XP_019237592.1 PREDICTED: ATP-citrate synthase alpha chain prote... 75 1e-13 XP_010276536.1 PREDICTED: ATP-citrate synthase alpha chain prote... 75 1e-13 >XP_014626982.1 PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Glycine max] KRG96682.1 hypothetical protein GLYMA_19G226100 [Glycine max] Length = 209 Score = 77.4 bits (189), Expect = 2e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMS+A Sbjct: 172 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSDA 209 >XP_016205627.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Arachis ipaensis] Length = 423 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA Sbjct: 386 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 423 >KRH68404.1 hypothetical protein GLYMA_03G228900 [Glycine max] Length = 329 Score = 78.6 bits (192), Expect = 4e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMSEA Sbjct: 292 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 329 >KHN43368.1 ATP-citrate synthase alpha chain protein 3 [Glycine soja] Length = 265 Score = 77.4 bits (189), Expect = 5e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMS+A Sbjct: 228 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSDA 265 >XP_003521649.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X2 [Glycine max] KHN14219.1 ATP-citrate synthase alpha chain protein 2 [Glycine soja] KRH68403.1 hypothetical protein GLYMA_03G228900 [Glycine max] Length = 423 Score = 78.6 bits (192), Expect = 6e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMSEA Sbjct: 386 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 423 >XP_006577202.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X1 [Glycine max] Length = 446 Score = 78.6 bits (192), Expect = 6e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMSEA Sbjct: 409 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 446 >XP_015968711.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Arachis duranensis] Length = 423 Score = 78.2 bits (191), Expect = 8e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCI+SEA Sbjct: 386 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIISEA 423 >XP_007163298.1 hypothetical protein PHAVU_001G222900g [Phaseolus vulgaris] ESW35292.1 hypothetical protein PHAVU_001G222900g [Phaseolus vulgaris] Length = 423 Score = 77.4 bits (189), Expect = 2e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMR+LGEELG+PIQVYGPEATMTGICKQAIDCIMSEA Sbjct: 386 AKMRSLGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 423 >KYP71605.1 ATP-citrate synthase [Cajanus cajan] Length = 398 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCIMS+A Sbjct: 361 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSKA 398 >XP_017416020.1 PREDICTED: LOW QUALITY PROTEIN: ATP-citrate synthase alpha chain protein 2 [Vigna angularis] Length = 422 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCI+SEA Sbjct: 385 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIISEA 422 >XP_014496356.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Vigna radiata var. radiata] Length = 423 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCI+SEA Sbjct: 386 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIISEA 423 >KOM39300.1 hypothetical protein LR48_Vigan03g268200 [Vigna angularis] Length = 452 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+PIQVYGPEATMTGICKQAIDCI+SEA Sbjct: 415 AKMRALGEELGVPIQVYGPEATMTGICKQAIDCIISEA 452 >KJB45487.1 hypothetical protein B456_007G308700 [Gossypium raimondii] Length = 290 Score = 75.5 bits (184), Expect = 4e-14 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 A+MRALGEELG+P++VYGPEATMTGICKQAIDCIMSEA Sbjct: 253 ARMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSEA 290 >XP_003579058.1 PREDICTED: ATP-citrate synthase alpha chain protein 3 [Brachypodium distachyon] KQJ86270.1 hypothetical protein BRADI_4g04390 [Brachypodium distachyon] Length = 423 Score = 76.3 bits (186), Expect = 4e-14 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALG ELGLPI+VYGPEATMTGICKQAIDC+MSEA Sbjct: 386 AKMRALGSELGLPIEVYGPEATMTGICKQAIDCVMSEA 423 >KJB45489.1 hypothetical protein B456_007G308700 [Gossypium raimondii] Length = 385 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 A+MRALGEELG+P++VYGPEATMTGICKQAIDCIMSEA Sbjct: 348 ARMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSEA 385 >XP_012434311.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Gossypium raimondii] XP_016713851.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Gossypium hirsutum] KJB45490.1 hypothetical protein B456_007G308700 [Gossypium raimondii] Length = 423 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 A+MRALGEELG+P++VYGPEATMTGICKQAIDCIMSEA Sbjct: 386 ARMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSEA 423 >KJB45486.1 hypothetical protein B456_007G308700 [Gossypium raimondii] Length = 423 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 A+MRALGEELG+P++VYGPEATMTGICKQAIDCIMSEA Sbjct: 386 ARMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSEA 423 >XP_008360239.2 PREDICTED: ATP-citrate synthase alpha chain protein 3 [Malus domestica] Length = 149 Score = 72.0 bits (175), Expect = 8e-14 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+P++VYGPEATMTGICKQAI+CI+ EA Sbjct: 112 AKMRALGEELGVPLEVYGPEATMTGICKQAIECIVDEA 149 >XP_019237592.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Nicotiana attenuata] OIT22302.1 atp-citrate synthase alpha chain protein 3 [Nicotiana attenuata] Length = 423 Score = 75.1 bits (183), Expect = 1e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMRALGEELG+P++VYGPEATMTGICK+AIDCIMSEA Sbjct: 386 AKMRALGEELGVPLEVYGPEATMTGICKRAIDCIMSEA 423 >XP_010276536.1 PREDICTED: ATP-citrate synthase alpha chain protein 3 [Nelumbo nucifera] Length = 423 Score = 75.1 bits (183), Expect = 1e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 AKMRALGEELGLPIQVYGPEATMTGICKQAIDCIMSEA 116 AKMR LGEELG+P++VYGPEATMTGICKQAIDCIMSEA Sbjct: 386 AKMRTLGEELGVPLEVYGPEATMTGICKQAIDCIMSEA 423