BLASTX nr result
ID: Glycyrrhiza35_contig00012165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00012165 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024580584.1 MULTISPECIES: aspartate aminotransferase family p... 187 7e-56 SEE26756.1 Adenosylmethionine-8-amino-7-oxononanoate aminotransf... 186 2e-55 WP_074125910.1 aspartate aminotransferase family protein [Bradyr... 185 5e-55 WP_050401515.1 aspartate aminotransferase family protein [Bradyr... 185 5e-55 WP_076863192.1 aspartate aminotransferase family protein [Bradyr... 185 6e-55 ERF86499.1 hypothetical protein C207_00480 [Bradyrhizobium sp. D... 183 2e-54 WP_050627670.1 aspartate aminotransferase family protein [Bradyr... 182 6e-54 SDD86593.1 Adenosylmethionine-8-amino-7-oxononanoate aminotransf... 181 1e-53 WP_050387877.1 aspartate aminotransferase family protein [Bradyr... 181 1e-53 WP_038388679.1 aspartate aminotransferase family protein [Bradyr... 181 1e-53 WP_028339574.1 aspartate aminotransferase family protein [Bradyr... 181 1e-53 WP_028336993.1 aspartate aminotransferase family protein [Bradyr... 181 1e-53 WP_066510600.1 aspartate aminotransferase family protein [Bradyr... 180 3e-53 WP_069279371.1 aspartate aminotransferase family protein [Bradyr... 179 1e-52 WP_018270328.1 aspartate aminotransferase family protein [Bradyr... 179 1e-52 WP_029081451.1 aspartate aminotransferase family protein [Bradyr... 178 2e-52 WP_076829039.1 aspartate aminotransferase family protein [Bradyr... 178 3e-52 WP_057018835.1 aspartate aminotransferase family protein [Bradyr... 178 3e-52 WP_044537091.1 aspartate aminotransferase family protein [Bradyr... 177 4e-52 WP_044592896.1 aspartate aminotransferase family protein [Bradyr... 175 3e-51 >WP_024580584.1 MULTISPECIES: aspartate aminotransferase family protein [Bradyrhizobium] KIU44548.1 hypothetical protein QU41_26755 [Bradyrhizobium elkanii] OCX26274.1 hypothetical protein QU42_33875 [Bradyrhizobium sp. UASWS1016] Length = 449 Score = 187 bits (475), Expect = 7e-56 Identities = 91/93 (97%), Positives = 91/93 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPEN 204 >SEE26756.1 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium erythrophlei] Length = 449 Score = 186 bits (472), Expect = 2e-55 Identities = 90/93 (96%), Positives = 91/93 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPEN 204 >WP_074125910.1 aspartate aminotransferase family protein [Bradyrhizobium sp. NAS96.2] OKO81724.1 hypothetical protein AC628_06020 [Bradyrhizobium sp. NAS96.2] Length = 449 Score = 185 bits (469), Expect = 5e-55 Identities = 89/93 (95%), Positives = 91/93 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPEN 204 >WP_050401515.1 aspartate aminotransferase family protein [Bradyrhizobium embrapense] Length = 449 Score = 185 bits (469), Expect = 5e-55 Identities = 89/93 (95%), Positives = 91/93 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPQRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPEN 204 >WP_076863192.1 aspartate aminotransferase family protein [Bradyrhizobium sp. SEMIA 6399] Length = 451 Score = 185 bits (469), Expect = 6e-55 Identities = 89/93 (95%), Positives = 91/93 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPEN 204 >ERF86499.1 hypothetical protein C207_00480 [Bradyrhizobium sp. DFCI-1] Length = 449 Score = 183 bits (465), Expect = 2e-54 Identities = 88/93 (94%), Positives = 90/93 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEKRDDESEA FV RLAAELEAEFQRLGPEN Sbjct: 172 AYHEKRDDESEAAFVGRLAAELEAEFQRLGPEN 204 >WP_050627670.1 aspartate aminotransferase family protein [Bradyrhizobium viridifuturi] Length = 449 Score = 182 bits (462), Expect = 6e-54 Identities = 88/93 (94%), Positives = 90/93 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPEN 1 AYHEK DDESEA FVARLAAELEAEFQRLGPEN Sbjct: 172 AYHEKPDDESEAAFVARLAAELEAEFQRLGPEN 204 >SDD86593.1 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium sp. R5] Length = 451 Score = 181 bits (460), Expect = 1e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_050387877.1 aspartate aminotransferase family protein [Bradyrhizobium pachyrhizi] Length = 451 Score = 181 bits (460), Expect = 1e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_038388679.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] Length = 451 Score = 181 bits (460), Expect = 1e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_028339574.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] Length = 451 Score = 181 bits (460), Expect = 1e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_028336993.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] Length = 451 Score = 181 bits (460), Expect = 1e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_066510600.1 aspartate aminotransferase family protein [Bradyrhizobium sp. BR 10303] KWV51851.1 hypothetical protein AS156_11395 [Bradyrhizobium sp. BR 10303] Length = 451 Score = 180 bits (457), Expect = 3e-53 Identities = 87/92 (94%), Positives = 90/92 (97%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAGFVARLAAELEAEFQRLGPD 203 >WP_069279371.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] ODM73451.1 hypothetical protein A6X20_37370 [Bradyrhizobium elkanii] ODM76651.1 hypothetical protein A6452_35045 [Bradyrhizobium elkanii] Length = 451 Score = 179 bits (454), Expect = 1e-52 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRR PYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRRAPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_018270328.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] OIM89980.1 aspartate aminotransferase family protein [Bradyrhizobium elkanii] Length = 451 Score = 179 bits (454), Expect = 1e-52 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRR PYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRRAPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_029081451.1 aspartate aminotransferase family protein [Bradyrhizobium sp. th.b2] Length = 451 Score = 178 bits (452), Expect = 2e-52 Identities = 85/92 (92%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGEPKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHE+RDDESEA FV RLAAELEAEFQRLGP+ Sbjct: 172 AYHEQRDDESEAAFVGRLAAELEAEFQRLGPD 203 >WP_076829039.1 aspartate aminotransferase family protein [Bradyrhizobium sp. UFLA 03-321] OMI06850.1 aspartate aminotransferase family protein [Bradyrhizobium sp. UFLA 03-321] Length = 451 Score = 178 bits (451), Expect = 3e-52 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGE RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGERKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_057018835.1 aspartate aminotransferase family protein [Bradyrhizobium pachyrhizi] KRP91354.1 hypothetical protein AOQ73_24635 [Bradyrhizobium pachyrhizi] Length = 451 Score = 178 bits (451), Expect = 3e-52 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGE RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSP+FSHVTPAF Sbjct: 112 KLARQYFIERGERKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPSFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEKRDDESEA FVARLAAELEAEFQRLGP+ Sbjct: 172 AYHEKRDDESEAAFVARLAAELEAEFQRLGPD 203 >WP_044537091.1 aspartate aminotransferase family protein [Bradyrhizobium sp. LTSP885] KJC50366.1 hypothetical protein UP09_04815 [Bradyrhizobium sp. LTSP885] Length = 449 Score = 177 bits (450), Expect = 4e-52 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGEP RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF Sbjct: 112 KLARQYFIERGEPRRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEK DDESEA FVARLAA+LEAEFQRLGP+ Sbjct: 172 AYHEKLDDESEAGFVARLAADLEAEFQRLGPD 203 >WP_044592896.1 aspartate aminotransferase family protein [Bradyrhizobium sp. LTSPM299] KJC54133.1 hypothetical protein UP10_40715 [Bradyrhizobium sp. LTSPM299] Length = 449 Score = 175 bits (444), Expect = 3e-51 Identities = 85/92 (92%), Positives = 88/92 (95%) Frame = -1 Query: 279 KLARQYFIERGEPNRARFIARKQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 100 KLARQYFIERGE RARFIAR+QSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF Sbjct: 112 KLARQYFIERGESKRARFIARRQSYHGNTLGALSAGGNAWRREPYAPLLSPAFSHVTPAF 171 Query: 99 AYHEKRDDESEAVFVARLAAELEAEFQRLGPE 4 AYHEK DDESEA FVARLAA+LEAEFQRLGP+ Sbjct: 172 AYHEKHDDESEAGFVARLAADLEAEFQRLGPD 203