BLASTX nr result
ID: Glycyrrhiza35_contig00012155
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00012155 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNE88863.1 hypothetical protein PSTG_17691, partial [Puccinia st... 69 1e-13 KZT12313.1 hypothetical protein LAESUDRAFT_641849 [Laetiporus su... 59 6e-09 XP_007270721.1 hypothetical protein FOMMEDRAFT_95236, partial [F... 57 7e-09 KDQ49121.1 hypothetical protein JAAARDRAFT_91570, partial [Jaapi... 55 2e-08 KDQ32209.1 hypothetical protein PLEOSDRAFT_1034940 [Pleurotus os... 54 2e-07 XP_007415537.1 hypothetical protein MELLADRAFT_92704 [Melampsora... 55 2e-07 KDQ49130.1 hypothetical protein JAAARDRAFT_74797 [Jaapia argilla... 55 3e-07 KII82849.1 hypothetical protein PLICRDRAFT_58617 [Plicaturopsis ... 52 5e-07 CDZ98108.1 hypothetical protein [Xanthophyllomyces dendrorhous] 54 5e-07 XP_007006356.1 hypothetical protein TREMEDRAFT_33303, partial [T... 50 2e-06 XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora... 50 5e-06 XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora... 50 5e-06 XP_007324731.1 hypothetical protein SERLADRAFT_353223 [Serpula l... 49 7e-06 XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora... 50 7e-06 XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora... 50 7e-06 XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora... 50 7e-06 XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora... 50 7e-06 XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora... 50 7e-06 XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora... 50 7e-06 EJU02321.1 hypothetical protein DACRYDRAFT_79103 [Dacryopinax pr... 43 7e-06 >KNE88863.1 hypothetical protein PSTG_17691, partial [Puccinia striiformis f. sp. tritici PST-78] Length = 63 Score = 68.6 bits (166), Expect = 1e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 107 EAYFNTTNTCGTNIIVSSTDSDLEAFSHNLADDSF 3 +AY+N+TN CGTNIIVSSTDSDLEAFSHNLADDSF Sbjct: 1 KAYYNSTNMCGTNIIVSSTDSDLEAFSHNLADDSF 35 >KZT12313.1 hypothetical protein LAESUDRAFT_641849 [Laetiporus sulphureus 93-53] Length = 186 Score = 59.3 bits (142), Expect = 6e-09 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -3 Query: 176 ISIQSKRHGPFRPRRPAQTWFTAEA--YFNTTNTCGTNIIVSSTDSDLEAFSHNLADDSF 3 I+I + F RP+ + E Y NT+ TCGTN++VSSTDS LEAFSHN ADDSF Sbjct: 2 IAIHKRATQAFPLGRPSPSDLVHEPKLYSNTSRTCGTNVVVSSTDSGLEAFSHNPADDSF 61 >XP_007270721.1 hypothetical protein FOMMEDRAFT_95236, partial [Fomitiporia mediterranea MF3/22] XP_007272416.1 hypothetical protein FOMMEDRAFT_100095, partial [Fomitiporia mediterranea MF3/22] EJC97320.1 hypothetical protein FOMMEDRAFT_100095, partial [Fomitiporia mediterranea MF3/22] EJC98830.1 hypothetical protein FOMMEDRAFT_95236, partial [Fomitiporia mediterranea MF3/22] Length = 103 Score = 57.4 bits (137), Expect = 7e-09 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 101 YFNTTNTCGTNIIVSSTDSDLEAFSHNLADDSF 3 YFNTT+ C TNIIVS TDS LEAFSHN ADDSF Sbjct: 10 YFNTTHMCRTNIIVSGTDSGLEAFSHNPADDSF 42 >KDQ49121.1 hypothetical protein JAAARDRAFT_91570, partial [Jaapia argillacea MUCL 33604] Length = 63 Score = 55.1 bits (131), Expect = 2e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+PVPIQVVCKGFTPAHI Sbjct: 5 VATRLLYRLQYPVPIQVVCKGFTPAHI 31 >KDQ32209.1 hypothetical protein PLEOSDRAFT_1034940 [Pleurotus ostreatus PC15] Length = 88 Score = 53.5 bits (127), Expect = 2e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 80 CGTNIIVSSTDSDLEAFSHNLADDSF 3 CGTNIIVSSTDSDLEAFSHN ADDSF Sbjct: 2 CGTNIIVSSTDSDLEAFSHNPADDSF 27 >XP_007415537.1 hypothetical protein MELLADRAFT_92704 [Melampsora larici-populina 98AG31] EGG01187.1 hypothetical protein MELLADRAFT_92704 [Melampsora larici-populina 98AG31] Length = 194 Score = 55.5 bits (132), Expect = 2e-07 Identities = 30/58 (51%), Positives = 36/58 (62%), Gaps = 9/58 (15%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI---------PFLSRASDTGLSAHAAQPKHGS 113 VATRLLY LQ+P IQVVCKGFTPAHI + ++D+ L A + P HGS Sbjct: 19 VATRLLYCLQYPALIQVVCKGFTPAHIFNTICNFMHQVIVSSTDSDLEAFSHNPTHGS 76 >KDQ49130.1 hypothetical protein JAAARDRAFT_74797 [Jaapia argillacea MUCL 33604] Length = 198 Score = 55.1 bits (131), Expect = 3e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+PVPIQVVCKGFTPAHI Sbjct: 11 VATRLLYRLQYPVPIQVVCKGFTPAHI 37 >KII82849.1 hypothetical protein PLICRDRAFT_58617 [Plicaturopsis crispa FD-325 SS-3] Length = 86 Score = 52.4 bits (124), Expect = 5e-07 Identities = 26/49 (53%), Positives = 28/49 (57%) Frame = -3 Query: 149 PFRPRRPAQTWFTAEAYFNTTNTCGTNIIVSSTDSDLEAFSHNLADDSF 3 P P T + CGTNI+VSSTDS LEAFSHN ADDSF Sbjct: 17 PLSRPNPPDTVHEQSSILTQVTMCGTNIVVSSTDSGLEAFSHNPADDSF 65 >CDZ98108.1 hypothetical protein [Xanthophyllomyces dendrorhous] Length = 137 Score = 53.5 bits (127), Expect = 5e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 80 CGTNIIVSSTDSDLEAFSHNLADDSF 3 CGTNIIVSSTDSDLEAFSHN ADDSF Sbjct: 2 CGTNIIVSSTDSDLEAFSHNPADDSF 27 >XP_007006356.1 hypothetical protein TREMEDRAFT_33303, partial [Tremella mesenterica DSM 1558] XP_007006383.1 hypothetical protein TREMEDRAFT_33474, partial [Tremella mesenterica DSM 1558] XP_007006396.1 hypothetical protein TREMEDRAFT_33553, partial [Tremella mesenterica DSM 1558] XP_007006397.1 hypothetical protein TREMEDRAFT_33557, partial [Tremella mesenterica DSM 1558] EIW67480.1 hypothetical protein TREMEDRAFT_33553, partial [Tremella mesenterica DSM 1558] EIW67486.1 hypothetical protein TREMEDRAFT_33303, partial [Tremella mesenterica DSM 1558] EIW67489.1 hypothetical protein TREMEDRAFT_33557, partial [Tremella mesenterica DSM 1558] EIW67494.1 hypothetical protein TREMEDRAFT_33474, partial [Tremella mesenterica DSM 1558] Length = 69 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 80 CGTNIIVSSTDSDLEAFSHNLADDSF 3 CGTN +VSSTDSDLEAFSHNLAD SF Sbjct: 1 CGTNNVVSSTDSDLEAFSHNLADGSF 26 >XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] EGF97270.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] Length = 98 Score = 50.1 bits (118), Expect = 5e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPAVIQVVCKGFTPAHI 55 >XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] EGG09856.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] Length = 85 Score = 49.7 bits (117), Expect = 5e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007324731.1 hypothetical protein SERLADRAFT_353223 [Serpula lacrymans var. lacrymans S7.9] XP_007324738.1 hypothetical protein SERLADRAFT_353196 [Serpula lacrymans var. lacrymans S7.9] XP_007324744.1 hypothetical protein SERLADRAFT_353213 [Serpula lacrymans var. lacrymans S7.9] EGN91020.1 hypothetical protein SERLA73DRAFT_67808 [Serpula lacrymans var. lacrymans S7.3] EGO18704.1 hypothetical protein SERLADRAFT_353223 [Serpula lacrymans var. lacrymans S7.9] EGO18711.1 hypothetical protein SERLADRAFT_353196 [Serpula lacrymans var. lacrymans S7.9] EGO18717.1 hypothetical protein SERLADRAFT_353213 [Serpula lacrymans var. lacrymans S7.9] Length = 82 Score = 49.3 bits (116), Expect = 7e-06 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = -3 Query: 176 ISIQSKRHGPFRPRRPAQTWFTAE-AYFNTTNTC-GTNIIVSSTDSDLEAFSHNLADDSF 3 I+I+ + F P P+ E + +T TC G NI+VSSTDS LEAFSHN ADDSF Sbjct: 2 ITIRRRTRQAFPPDEPSPPDLVHEQSSISTQLTCAGPNIVVSSTDSGLEAFSHNPADDSF 61 >XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] EGF99323.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] Length = 97 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 28 VATRLLYCLQYPALIQVVCKGFTPAHI 54 >XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] EGF98954.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] Length = 97 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 28 VATRLLYCLQYPALIQVVCKGFTPAHI 54 >XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] EGG00440.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] Length = 98 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] EGF99027.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] Length = 98 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] XP_007411657.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] XP_007413078.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] XP_007413995.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] XP_007414496.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] XP_007414630.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] XP_007415541.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] XP_007417444.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] XP_007418188.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] XP_007419025.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF97702.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF98537.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] EGF99310.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] EGG01191.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] EGG02093.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] EGG02239.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] EGG02882.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] EGG03631.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] EGG05292.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] EGG06255.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] Length = 98 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] XP_007419047.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGF97685.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGG05065.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] Length = 98 Score = 49.7 bits (117), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 259 VATRLLYYLQHPVPIQVVCKGFTPAHI 179 VATRLLY LQ+P IQVVCKGFTPAHI Sbjct: 29 VATRLLYCLQYPALIQVVCKGFTPAHI 55 >EJU02321.1 hypothetical protein DACRYDRAFT_79103 [Dacryopinax primogenitus] Length = 81 Score = 43.1 bits (100), Expect(2) = 7e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -3 Query: 68 IIVSSTDSDLEAFSHNLADDSF 3 I+VSSTDSDLEAFSHN ADDSF Sbjct: 39 IVVSSTDSDLEAFSHNPADDSF 60 Score = 33.9 bits (76), Expect(2) = 7e-06 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 135 PPSPNMVHSRSLF*HN*HVRDQ 70 P PN+VH RSLF HN H RD+ Sbjct: 17 PSPPNVVHDRSLFQHNSHARDK 38