BLASTX nr result
ID: Glycyrrhiza35_contig00011982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00011982 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP44501.1 hypothetical protein KK1_034022 [Cajanus cajan] 54 3e-07 GAU14817.1 hypothetical protein TSUD_50290 [Trifolium subterraneum] 58 3e-07 >KYP44501.1 hypothetical protein KK1_034022 [Cajanus cajan] Length = 65 Score = 54.3 bits (129), Expect = 3e-07 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 417 VGTESGGALKDCVRDDGRYGLTVGDVRNVRSP-LKDETESHL 295 +G ES G K V+DDGRYG TVGD+RN RSP L++ TESHL Sbjct: 12 IGVESDGVHKVYVKDDGRYGFTVGDMRNARSPLLQNVTESHL 53 >GAU14817.1 hypothetical protein TSUD_50290 [Trifolium subterraneum] Length = 266 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -1 Query: 417 VGTESGGALKDCVRDDGRYGLTVGDVRNVRSPLKDETESHL 295 VG ESGG K VRDDGRY LTVGD+RNV SPL D TES L Sbjct: 214 VGIESGGVQKVYVRDDGRYELTVGDMRNVLSPLGDLTESQL 254