BLASTX nr result
ID: Glycyrrhiza35_contig00011258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00011258 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAA62913.1 hypothetical protein SPI_04453 [Sporothrix insectorum... 57 7e-11 OBS20199.1 hypothetical protein FPOA_11921 [Fusarium poae] 65 1e-10 XP_013955648.1 hypothetical protein TRIVIDRAFT_180510, partial [... 60 1e-10 KIL83635.1 hypothetical protein FAVG1_13142 [Fusarium avenaceum] 62 2e-09 >OAA62913.1 hypothetical protein SPI_04453 [Sporothrix insectorum RCEF 264] Length = 367 Score = 56.6 bits (135), Expect(2) = 7e-11 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 85 AYCNFDTRGIKSFADDLAVRKGPVSSRV 2 A CNFDTRGIKSFADDLAVRKGPVSSRV Sbjct: 39 ADCNFDTRGIKSFADDLAVRKGPVSSRV 66 Score = 37.4 bits (85), Expect(2) = 7e-11 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -1 Query: 198 MPERDDTSRTL*TYKNRLRPRILAG 124 MPER TSRTL T +NRLRPRI AG Sbjct: 1 MPERGATSRTLQTDQNRLRPRISAG 25 >OBS20199.1 hypothetical protein FPOA_11921 [Fusarium poae] Length = 1045 Score = 65.1 bits (157), Expect = 1e-10 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 3 TLLLTGPFRTAKSSAKDLIPRVSKLQYANYYRSLRER*RNRQLR 134 TLLLTGPFRTAKSSAKDL P V KLQYANY+ +LR RNR LR Sbjct: 1001 TLLLTGPFRTAKSSAKDLTPLVLKLQYANYHDALRAPWRNRLLR 1044 >XP_013955648.1 hypothetical protein TRIVIDRAFT_180510, partial [Trichoderma virens Gv29-8] XP_013955653.1 hypothetical protein TRIVIDRAFT_180512, partial [Trichoderma virens Gv29-8] XP_013955657.1 hypothetical protein TRIVIDRAFT_170752, partial [Trichoderma virens Gv29-8] XP_013955661.1 hypothetical protein TRIVIDRAFT_170754, partial [Trichoderma virens Gv29-8] XP_013955665.1 hypothetical protein TRIVIDRAFT_180518, partial [Trichoderma virens Gv29-8] EHK21455.1 hypothetical protein TRIVIDRAFT_180510, partial [Trichoderma virens Gv29-8] EHK21460.1 hypothetical protein TRIVIDRAFT_180512, partial [Trichoderma virens Gv29-8] EHK21464.1 hypothetical protein TRIVIDRAFT_170752, partial [Trichoderma virens Gv29-8] EHK21468.1 hypothetical protein TRIVIDRAFT_170754, partial [Trichoderma virens Gv29-8] EHK21472.1 hypothetical protein TRIVIDRAFT_180518, partial [Trichoderma virens Gv29-8] Length = 62 Score = 60.1 bits (144), Expect = 1e-10 Identities = 33/44 (75%), Positives = 33/44 (75%) Frame = +3 Query: 3 TLLLTGPFRTAKSSAKDLIPRVSKLQYANYYRSLRER*RNRQLR 134 TLLLTGPFRTAKSSAKDL P V KLQYA Y LR RNR LR Sbjct: 18 TLLLTGPFRTAKSSAKDLTPLVLKLQYAKYRGPLRGPRRNRLLR 61 >KIL83635.1 hypothetical protein FAVG1_13142 [Fusarium avenaceum] Length = 1083 Score = 61.6 bits (148), Expect = 2e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +3 Query: 3 TLLLTGPFRTAKSSAKDLIPRVSKLQYANYYRSLRER*RNRQLR 134 TLLLTGPFRTAKSSAKDL P V KLQYA Y+ +LR +NR LR Sbjct: 1039 TLLLTGPFRTAKSSAKDLTPLVLKLQYAKYHDTLRAPWKNRLLR 1082