BLASTX nr result
ID: Glycyrrhiza35_contig00010600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00010600 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAO02521.1 predicted Rac-like GTPase ortholog, partial [Nicotian... 59 3e-09 AAB87673.1 Rho-like GTP binding protein, partial [Arabidopsis th... 59 4e-09 CDP17200.1 unnamed protein product [Coffea canephora] 59 5e-09 XP_018481431.1 PREDICTED: uncharacterized protein LOC108852423 [... 59 6e-09 JAU85619.1 Rac-like GTP-binding protein ARAC3, partial [Noccaea ... 62 7e-09 KCW53194.1 hypothetical protein EUGRSUZ_J02468 [Eucalyptus grandis] 59 9e-09 AQK67929.1 Rho-related protein from plants 9 [Zea mays] 59 9e-09 JAU56988.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea ... 61 1e-08 JAU16942.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea ... 61 1e-08 EYU38786.1 hypothetical protein MIMGU_mgv1a0191691mg, partial [E... 57 1e-08 JAU90580.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea ... 61 1e-08 XP_019058975.1 PREDICTED: rac-like GTP-binding protein RHO1 [Tar... 59 1e-08 KDO84914.1 hypothetical protein CISIN_1g029215mg [Citrus sinensis] 59 1e-08 KRH61025.1 hypothetical protein GLYMA_04G023300 [Glycine max] 59 1e-08 NP_001327974.1 RAC-like 3 [Arabidopsis thaliana] NP_001327973.1 ... 59 1e-08 CAN76011.1 hypothetical protein VITISV_022908, partial [Vitis vi... 59 1e-08 AQK76500.1 Rho-related protein from plants 4 [Zea mays] 59 1e-08 KJB59750.1 hypothetical protein B456_009G269600 [Gossypium raimo... 59 1e-08 KJB47673.1 hypothetical protein B456_008G036100 [Gossypium raimo... 59 1e-08 KJB47672.1 hypothetical protein B456_008G036100 [Gossypium raimo... 59 1e-08 >BAO02521.1 predicted Rac-like GTPase ortholog, partial [Nicotiana alata] Length = 81 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >AAB87673.1 Rho-like GTP binding protein, partial [Arabidopsis thaliana] Length = 99 Score = 59.3 bits (142), Expect = 4e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >CDP17200.1 unnamed protein product [Coffea canephora] Length = 108 Score = 59.3 bits (142), Expect = 5e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >XP_018481431.1 PREDICTED: uncharacterized protein LOC108852423 [Raphanus sativus] Length = 100 Score = 58.9 bits (141), Expect = 6e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGA+GKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAIGKTCLLISYTS 28 >JAU85619.1 Rac-like GTP-binding protein ARAC3, partial [Noccaea caerulescens] Length = 250 Score = 61.6 bits (148), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 288 KKMSASRFIKCVTVGDGAVGKTCLLISYTS 377 +KMSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 51 EKMSASRFIKCVTVGDGAVGKTCLLISYTS 80 >KCW53194.1 hypothetical protein EUGRSUZ_J02468 [Eucalyptus grandis] Length = 129 Score = 59.3 bits (142), Expect = 9e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >AQK67929.1 Rho-related protein from plants 9 [Zea mays] Length = 102 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTC+LISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTS 28 >JAU56988.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea caerulescens] Length = 221 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 282 KQKKMSASRFIKCVTVGDGAVGKTCLLISYTS 377 ++KKMS +RFIKCVTVGDGAVGKTC+LISYTS Sbjct: 17 RRKKMSTARFIKCVTVGDGAVGKTCMLISYTS 48 >JAU16942.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea caerulescens] Length = 221 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 282 KQKKMSASRFIKCVTVGDGAVGKTCLLISYTS 377 ++KKMS +RFIKCVTVGDGAVGKTC+LISYTS Sbjct: 17 RRKKMSTARFIKCVTVGDGAVGKTCMLISYTS 48 >EYU38786.1 hypothetical protein MIMGU_mgv1a0191691mg, partial [Erythranthe guttata] Length = 62 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSA+RFIKCVTVGDGAVGKTC+LISYTS Sbjct: 1 MSATRFIKCVTVGDGAVGKTCMLISYTS 28 >JAU90580.1 Rac-like GTP-binding protein ARAC2, partial [Noccaea caerulescens] Length = 222 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 282 KQKKMSASRFIKCVTVGDGAVGKTCLLISYTS 377 ++KKMS +RFIKCVTVGDGAVGKTC+LISYTS Sbjct: 18 RRKKMSTARFIKCVTVGDGAVGKTCMLISYTS 49 >XP_019058975.1 PREDICTED: rac-like GTP-binding protein RHO1 [Tarenaya hassleriana] Length = 141 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >KDO84914.1 hypothetical protein CISIN_1g029215mg [Citrus sinensis] Length = 110 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTC+LISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTS 28 >KRH61025.1 hypothetical protein GLYMA_04G023300 [Glycine max] Length = 143 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >NP_001327974.1 RAC-like 3 [Arabidopsis thaliana] NP_001327973.1 RAC-like 3 [Arabidopsis thaliana] ANM66047.1 RAC-like 3 [Arabidopsis thaliana] ANM66048.1 RAC-like 3 [Arabidopsis thaliana] Length = 146 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >CAN76011.1 hypothetical protein VITISV_022908, partial [Vitis vinifera] Length = 148 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >AQK76500.1 Rho-related protein from plants 4 [Zea mays] Length = 119 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTC+LISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTS 28 >KJB59750.1 hypothetical protein B456_009G269600 [Gossypium raimondii] Length = 153 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >KJB47673.1 hypothetical protein B456_008G036100 [Gossypium raimondii] Length = 153 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28 >KJB47672.1 hypothetical protein B456_008G036100 [Gossypium raimondii] Length = 153 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 294 MSASRFIKCVTVGDGAVGKTCLLISYTS 377 MSASRFIKCVTVGDGAVGKTCLLISYTS Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTS 28