BLASTX nr result
ID: Glycyrrhiza35_contig00009818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00009818 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDI66870.1 Putative uncharacterized protein [Bifidobacterium ani... 52 8e-07 EEQ56088.1 hypothetical protein BLIG_02218 [Bifidobacterium long... 52 8e-07 >CDI66870.1 Putative uncharacterized protein [Bifidobacterium animalis subsp. animalis IM386] Length = 94 Score = 52.0 bits (123), Expect = 8e-07 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -1 Query: 169 HS*FSAWTTRVSNPIRSPSLRPSTSVIT*RFAFAVIRPISIKTFYLYSNGSNI 11 H F+AWTTRVSNP+RSP R S SV R AFA+ I TF+ Y+ S++ Sbjct: 27 HPPFTAWTTRVSNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSL 79 >EEQ56088.1 hypothetical protein BLIG_02218 [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 94 Score = 52.0 bits (123), Expect = 8e-07 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -1 Query: 169 HS*FSAWTTRVSNPIRSPSLRPSTSVIT*RFAFAVIRPISIKTFYLYSNGSNI 11 H F+AWTTRVSNP+RSP R S SV R AFA+ I TF+ Y+ S++ Sbjct: 27 HPPFTAWTTRVSNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSL 79