BLASTX nr result
ID: Glycyrrhiza35_contig00009620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00009620 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017411383.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 87 4e-19 XP_017411382.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 87 5e-19 XP_017411381.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 87 5e-19 XP_014518488.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 89 1e-18 KYP78852.1 BRASSINOSTEROID INSENSITIVE 1-associated receptor kin... 88 3e-18 XP_017411380.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 87 5e-18 BAT86847.1 hypothetical protein VIGAN_05016900 [Vigna angularis ... 87 5e-18 KOM30339.1 hypothetical protein LR48_Vigan1210s000400 [Vigna ang... 87 5e-18 XP_006432470.1 hypothetical protein CICLE_v100027481mg, partial ... 80 7e-18 KRH10502.1 hypothetical protein GLYMA_15G0516002, partial [Glyci... 82 1e-17 XP_019440371.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 86 2e-17 XP_019440370.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 86 2e-17 GAU40113.1 hypothetical protein TSUD_389630 [Trifolium subterran... 85 2e-17 XP_019419322.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 86 2e-17 XP_019419320.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 86 2e-17 XP_016463434.1 PREDICTED: V-type proton ATPase subunit D-like, p... 79 6e-17 XP_006584457.1 PREDICTED: somatic embryogenesis receptor-like ki... 84 6e-17 KHN26729.1 BRASSINOSTEROID INSENSITIVE 1-associated receptor kin... 84 6e-17 XP_011004969.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 83 2e-16 XP_011004968.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associat... 83 2e-16 >XP_017411383.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X3 [Vigna angularis] Length = 223 Score = 87.4 bits (215), Expect = 4e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >XP_017411382.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X2 [Vigna angularis] Length = 235 Score = 87.4 bits (215), Expect = 5e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >XP_017411381.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X1 [Vigna angularis] BAT86846.1 hypothetical protein VIGAN_05016700 [Vigna angularis var. angularis] Length = 240 Score = 87.4 bits (215), Expect = 5e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >XP_014518488.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Vigna radiata var. radiata] Length = 616 Score = 89.0 bits (219), Expect = 1e-18 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNITGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >KYP78852.1 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Cajanus cajan] Length = 616 Score = 88.2 bits (217), Expect = 3e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIPDELGNLTNLVSLDLYLN LTG IP+TLGNLAKLRF Sbjct: 102 LYSNNITGKIPDELGNLTNLVSLDLYLNTLTGPIPTTLGNLAKLRF 147 >XP_017411380.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like [Vigna angularis] Length = 617 Score = 87.4 bits (215), Expect = 5e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >BAT86847.1 hypothetical protein VIGAN_05016900 [Vigna angularis var. angularis] Length = 617 Score = 87.4 bits (215), Expect = 5e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 102 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 147 >KOM30339.1 hypothetical protein LR48_Vigan1210s000400 [Vigna angularis] Length = 774 Score = 87.4 bits (215), Expect = 5e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 123 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 168 Score = 87.4 bits (215), Expect = 5e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIP+ELGNLTNLVSLDLYLN LTGSIP+TLGNLAKLRF Sbjct: 259 LYSNNISGKIPEELGNLTNLVSLDLYLNNLTGSIPTTLGNLAKLRF 304 >XP_006432470.1 hypothetical protein CICLE_v100027481mg, partial [Citrus clementina] ESR45710.1 hypothetical protein CICLE_v100027481mg, partial [Citrus clementina] Length = 60 Score = 79.7 bits (195), Expect = 7e-18 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GK+P+ELGNLTNLVSLDLYLN L G IP+TLG L+KLRF Sbjct: 2 LYSNNISGKVPEELGNLTNLVSLDLYLNNLNGPIPTTLGKLSKLRF 47 >KRH10502.1 hypothetical protein GLYMA_15G0516002, partial [Glycine max] Length = 148 Score = 81.6 bits (200), Expect = 1e-17 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSN ITGKIPDELGNLTNLVSLDLYLN L G IP+TLG LAKLRF Sbjct: 102 LYSNKITGKIPDELGNLTNLVSLDLYLNTLNGPIPTTLGKLAKLRF 147 >XP_019440371.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X2 [Lupinus angustifolius] Length = 587 Score = 85.9 bits (211), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIPDE+GNLTNLVSLDLYLNKLTG IP+TLG L KLRF Sbjct: 98 LYSNNITGKIPDEIGNLTNLVSLDLYLNKLTGPIPNTLGKLGKLRF 143 >XP_019440370.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X1 [Lupinus angustifolius] OIW13625.1 hypothetical protein TanjilG_07967 [Lupinus angustifolius] Length = 611 Score = 85.9 bits (211), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIPDE+GNLTNLVSLDLYLNKLTG IP+TLG L KLRF Sbjct: 98 LYSNNITGKIPDEIGNLTNLVSLDLYLNKLTGPIPNTLGKLGKLRF 143 >GAU40113.1 hypothetical protein TSUD_389630 [Trifolium subterraneum] Length = 345 Score = 84.7 bits (208), Expect = 2e-17 Identities = 43/61 (70%), Positives = 48/61 (78%), Gaps = 10/61 (16%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF----------HFPI 151 LYSNNITGKIP+ELGNLTNLVSLDLYLN L+G+IP+TLGNL KLRF H P+ Sbjct: 78 LYSNNITGKIPEELGNLTNLVSLDLYLNNLSGNIPTTLGNLQKLRFLRLNNNTLTGHIPV 137 Query: 150 L 148 L Sbjct: 138 L 138 >XP_019419322.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X3 [Lupinus angustifolius] Length = 587 Score = 85.5 bits (210), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIPDE+GNLTNLVSLDLYLNKLTG IP+TLG LA LRF Sbjct: 98 LYSNNITGKIPDEIGNLTNLVSLDLYLNKLTGPIPNTLGKLANLRF 143 >XP_019419320.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X1 [Lupinus angustifolius] XP_019419321.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X2 [Lupinus angustifolius] Length = 611 Score = 85.5 bits (210), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIPDE+GNLTNLVSLDLYLNKLTG IP+TLG LA LRF Sbjct: 98 LYSNNITGKIPDEIGNLTNLVSLDLYLNKLTGPIPNTLGKLANLRF 143 >XP_016463434.1 PREDICTED: V-type proton ATPase subunit D-like, partial [Nicotiana tabacum] Length = 128 Score = 79.3 bits (194), Expect = 6e-17 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 124 MSGQSQRLNVVPTVTMLGVMKARLVGATRGHALLKKKSDAL 2 MSGQSQRLNVVPTVTMLGV+KARLVGATRGHALLKKKSDAL Sbjct: 1 MSGQSQRLNVVPTVTMLGVIKARLVGATRGHALLKKKSDAL 41 >XP_006584457.1 PREDICTED: somatic embryogenesis receptor-like kinase-like protein isoform X1 [Glycine max] KRH43924.1 hypothetical protein GLYMA_08G180800 [Glycine max] Length = 616 Score = 84.3 bits (207), Expect = 6e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIP+ELGNLTNLVSLDLYLN L G IP+TLGNLAKLRF Sbjct: 102 LYSNNITGKIPEELGNLTNLVSLDLYLNTLDGPIPTTLGNLAKLRF 147 >KHN26729.1 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Glycine soja] Length = 644 Score = 84.3 bits (207), Expect = 6e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNITGKIP+ELGNLTNLVSLDLYLN L G IP+TLGNLAKLRF Sbjct: 102 LYSNNITGKIPEELGNLTNLVSLDLYLNTLDGPIPTTLGNLAKLRF 147 >XP_011004969.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X2 [Populus euphratica] Length = 587 Score = 83.2 bits (204), Expect = 2e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIPDELGNLTNLVSLDLYLNKL+G IP TLG L KLRF Sbjct: 75 LYSNNISGKIPDELGNLTNLVSLDLYLNKLSGQIPKTLGQLQKLRF 120 >XP_011004968.1 PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like isoform X1 [Populus euphratica] Length = 607 Score = 83.2 bits (204), Expect = 2e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -2 Query: 300 LYSNNITGKIPDELGNLTNLVSLDLYLNKLTGSIPSTLGNLAKLRF 163 LYSNNI+GKIPDELGNLTNLVSLDLYLNKL+G IP TLG L KLRF Sbjct: 95 LYSNNISGKIPDELGNLTNLVSLDLYLNKLSGQIPKTLGQLQKLRF 140