BLASTX nr result
ID: Glycyrrhiza35_contig00009539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00009539 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela... 92 5e-23 XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes v... 63 1e-11 XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [D... 55 1e-08 >EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia subvermispora B] Length = 87 Score = 92.4 bits (228), Expect = 5e-23 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = -2 Query: 217 TGRLKPLRQHPKLGSGRTPAIKASCDPQSRPTYATGGYNTPGGATFPQPLSAGQN*C*PV 38 TGRLKPLRQHPK GRTP IKA C+P+S+P+YAT GYNTP GATFP P S +N C PV Sbjct: 11 TGRLKPLRQHPKHERGRTPTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWPV 70 Query: 37 GRE 29 R+ Sbjct: 71 DRK 73 >XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] EIW51413.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] Length = 51 Score = 62.8 bits (151), Expect = 1e-11 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -2 Query: 163 PAIKASCDPQSRPTYATGGYNTPGGATFPQPLSAGQN*C*PVGRE 29 P+ KA C P+S+P YAT GYNTP GATF QP S+GQN C PV R+ Sbjct: 5 PSHKARCVPRSQPLYATEGYNTPEGATFLQPFSSGQNRCWPVNRK 49 >XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] EJF55541.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] Length = 59 Score = 55.1 bits (131), Expect = 1e-08 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = -2 Query: 163 PAIKASCDPQSRPTYATGGYNTPGGATFPQPLSAGQN*C*PVGRE 29 P + A C P+S+P YAT YNTP GAT QP S GQN C PV R+ Sbjct: 1 PCLAARCVPRSQPPYATRVYNTPEGATLLQPFSDGQNRCWPVNRK 45