BLASTX nr result
ID: Glycyrrhiza35_contig00009089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00009089 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572714.1 PREDICTED: nucleolin 1 isoform X2 [Cicer arietinum] 141 8e-38 XP_004505720.1 PREDICTED: nucleolin 2 isoform X1 [Cicer arietinum] 141 1e-37 XP_007131647.1 hypothetical protein PHAVU_011G030600g [Phaseolus... 135 2e-35 XP_014494302.1 PREDICTED: nucleolin 1 isoform X2 [Vigna radiata ... 133 1e-34 XP_014494301.1 PREDICTED: nucleolin 1 isoform X1 [Vigna radiata ... 133 1e-34 GAU38333.1 hypothetical protein TSUD_61940 [Trifolium subterraneum] 132 1e-34 XP_019454269.1 PREDICTED: nucleolin 1-like [Lupinus angustifolius] 131 2e-34 OIW05625.1 hypothetical protein TanjilG_23411 [Lupinus angustifo... 131 3e-34 XP_019413228.1 PREDICTED: nucleolin 1-like isoform X11 [Lupinus ... 131 3e-34 XP_019413227.1 PREDICTED: nucleolin 1-like isoform X10 [Lupinus ... 131 5e-34 XP_019413226.1 PREDICTED: nucleolin 1-like isoform X9 [Lupinus a... 131 5e-34 XP_019413225.1 PREDICTED: nucleolin 1-like isoform X8 [Lupinus a... 131 5e-34 XP_019413224.1 PREDICTED: nucleolin 1-like isoform X7 [Lupinus a... 131 5e-34 XP_019413223.1 PREDICTED: nucleolin 1-like isoform X6 [Lupinus a... 131 6e-34 XP_019413222.1 PREDICTED: nucleolin 1-like isoform X5 [Lupinus a... 131 6e-34 XP_006592048.1 PREDICTED: nucleolin 1 isoform X3 [Glycine max] 130 6e-34 XP_019413221.1 PREDICTED: nucleolin 2-like isoform X4 [Lupinus a... 131 6e-34 XP_019413220.1 PREDICTED: nucleolin 2-like isoform X3 [Lupinus a... 131 6e-34 XP_019413219.1 PREDICTED: nucleolin 2-like isoform X2 [Lupinus a... 131 6e-34 XP_019413218.1 PREDICTED: nucleolin 2-like isoform X1 [Lupinus a... 131 6e-34 >XP_012572714.1 PREDICTED: nucleolin 1 isoform X2 [Cicer arietinum] Length = 573 Score = 141 bits (355), Expect = 8e-38 Identities = 67/76 (88%), Positives = 72/76 (94%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIRASLEEHF SCGE+TRVSIPKDYDSG VKGFAYMDFKDSDS KALELHES+LGGY Sbjct: 430 EDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGY 489 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPR+++QGS Sbjct: 490 TLSVDEAKPRESNQGS 505 >XP_004505720.1 PREDICTED: nucleolin 2 isoform X1 [Cicer arietinum] Length = 615 Score = 141 bits (355), Expect = 1e-37 Identities = 67/76 (88%), Positives = 72/76 (94%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIRASLEEHF SCGE+TRVSIPKDYDSG VKGFAYMDFKDSDS KALELHES+LGGY Sbjct: 472 EDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGY 531 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPR+++QGS Sbjct: 532 TLSVDEAKPRESNQGS 547 >XP_007131647.1 hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris] ESW03641.1 hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris] Length = 693 Score = 135 bits (340), Expect = 2e-35 Identities = 65/76 (85%), Positives = 72/76 (94%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIR+SLEEHFGSCGEVTRVSIPKDY++GAVKGFAYMDF D+D +KALELHE++LGGY Sbjct: 544 EDEIRSSLEEHFGSCGEVTRVSIPKDYETGAVKGFAYMDFSDADGISKALELHETELGGY 603 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPRDN QGS Sbjct: 604 TLSVDEAKPRDN-QGS 618 >XP_014494302.1 PREDICTED: nucleolin 1 isoform X2 [Vigna radiata var. radiata] Length = 708 Score = 133 bits (335), Expect = 1e-34 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIRASLEEHFGSCGE+TRVSIPKDY++GAVKGFAY+DF DSDS +KALELHE++LGGY Sbjct: 551 EDEIRASLEEHFGSCGEITRVSIPKDYETGAVKGFAYLDFGDSDSISKALELHETELGGY 610 Query: 182 TLSVDEAKPRDN 217 TL+VDEAKP+DN Sbjct: 611 TLTVDEAKPKDN 622 >XP_014494301.1 PREDICTED: nucleolin 1 isoform X1 [Vigna radiata var. radiata] Length = 747 Score = 133 bits (335), Expect = 1e-34 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIRASLEEHFGSCGE+TRVSIPKDY++GAVKGFAY+DF DSDS +KALELHE++LGGY Sbjct: 590 EDEIRASLEEHFGSCGEITRVSIPKDYETGAVKGFAYLDFGDSDSISKALELHETELGGY 649 Query: 182 TLSVDEAKPRDN 217 TL+VDEAKP+DN Sbjct: 650 TLTVDEAKPKDN 661 >GAU38333.1 hypothetical protein TSUD_61940 [Trifolium subterraneum] Length = 619 Score = 132 bits (333), Expect = 1e-34 Identities = 67/76 (88%), Positives = 70/76 (92%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIR+ LEEHFGSCGEVTRVSIPKDYDSG VKGFAYMDFKDSDS +KALEL S+LGGY Sbjct: 482 EDEIRSKLEEHFGSCGEVTRVSIPKDYDSGFVKGFAYMDFKDSDSMSKALELGGSELGGY 541 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPRD SQGS Sbjct: 542 TLSVDEAKPRD-SQGS 556 >XP_019454269.1 PREDICTED: nucleolin 1-like [Lupinus angustifolius] Length = 553 Score = 131 bits (330), Expect = 2e-34 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 E+EI++SLE+HFG+CG++TR+SIPKDYDSG KGFAY+DFKD DS +KALELHESDLGGY Sbjct: 403 EEEIKSSLEDHFGTCGQITRISIPKDYDSGESKGFAYLDFKDGDSLSKALELHESDLGGY 462 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPRDN QGS Sbjct: 463 TLSVDEAKPRDN-QGS 477 >OIW05625.1 hypothetical protein TanjilG_23411 [Lupinus angustifolius] Length = 566 Score = 131 bits (330), Expect = 3e-34 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 E+EI++SLE+HFG+CG++TR+SIPKDYDSG KGFAY+DFKD DS +KALELHESDLGGY Sbjct: 405 EEEIKSSLEDHFGTCGQITRISIPKDYDSGESKGFAYLDFKDGDSLSKALELHESDLGGY 464 Query: 182 TLSVDEAKPRDNSQGS 229 TLSVDEAKPRDN QGS Sbjct: 465 TLSVDEAKPRDN-QGS 479 >XP_019413228.1 PREDICTED: nucleolin 1-like isoform X11 [Lupinus angustifolius] Length = 552 Score = 131 bits (329), Expect = 3e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 407 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 466 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 467 TLSVDEAKPRDS 478 >XP_019413227.1 PREDICTED: nucleolin 1-like isoform X10 [Lupinus angustifolius] Length = 636 Score = 131 bits (329), Expect = 5e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 491 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 550 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 551 TLSVDEAKPRDS 562 >XP_019413226.1 PREDICTED: nucleolin 1-like isoform X9 [Lupinus angustifolius] Length = 638 Score = 131 bits (329), Expect = 5e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 493 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 552 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 553 TLSVDEAKPRDS 564 >XP_019413225.1 PREDICTED: nucleolin 1-like isoform X8 [Lupinus angustifolius] Length = 638 Score = 131 bits (329), Expect = 5e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 493 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 552 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 553 TLSVDEAKPRDS 564 >XP_019413224.1 PREDICTED: nucleolin 1-like isoform X7 [Lupinus angustifolius] Length = 639 Score = 131 bits (329), Expect = 5e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 494 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 553 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 554 TLSVDEAKPRDS 565 >XP_019413223.1 PREDICTED: nucleolin 1-like isoform X6 [Lupinus angustifolius] Length = 642 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 497 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 556 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 557 TLSVDEAKPRDS 568 >XP_019413222.1 PREDICTED: nucleolin 1-like isoform X5 [Lupinus angustifolius] Length = 647 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 502 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 561 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 562 TLSVDEAKPRDS 573 >XP_006592048.1 PREDICTED: nucleolin 1 isoform X3 [Glycine max] Length = 585 Score = 130 bits (328), Expect = 6e-34 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDEIR SL+EHFGSCG++TRVSIPKDY+SGAVKGFAY+DF D DS KALELHE++LGGY Sbjct: 428 EDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGY 487 Query: 182 TLSVDEAKPRDNSQGS 229 TL+VDEAKPRDN QGS Sbjct: 488 TLTVDEAKPRDN-QGS 502 >XP_019413221.1 PREDICTED: nucleolin 2-like isoform X4 [Lupinus angustifolius] OIV99588.1 hypothetical protein TanjilG_17398 [Lupinus angustifolius] Length = 657 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 512 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 571 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 572 TLSVDEAKPRDS 583 >XP_019413220.1 PREDICTED: nucleolin 2-like isoform X3 [Lupinus angustifolius] Length = 679 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 534 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 593 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 594 TLSVDEAKPRDS 605 >XP_019413219.1 PREDICTED: nucleolin 2-like isoform X2 [Lupinus angustifolius] Length = 679 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 534 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 593 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 594 TLSVDEAKPRDS 605 >XP_019413218.1 PREDICTED: nucleolin 2-like isoform X1 [Lupinus angustifolius] Length = 680 Score = 131 bits (329), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = +2 Query: 2 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYMDFKDSDSFNKALELHESDLGGY 181 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 535 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 594 Query: 182 TLSVDEAKPRDN 217 TLSVDEAKPRD+ Sbjct: 595 TLSVDEAKPRDS 606