BLASTX nr result
ID: Glycyrrhiza35_contig00008783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00008783 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010097202.1 hypothetical protein L484_025749 [Morus notabilis... 100 3e-25 XP_016477211.1 PREDICTED: signal recognition particle 54 kDa pro... 98 2e-23 XP_017978974.1 PREDICTED: signal recognition particle 54 kDa pro... 102 7e-23 XP_011073411.1 PREDICTED: signal recognition particle 54 kDa pro... 102 7e-23 XP_002517663.1 PREDICTED: signal recognition particle 54 kDa pro... 102 7e-23 KCW54894.1 hypothetical protein EUGRSUZ_I00867 [Eucalyptus grandis] 96 1e-22 XP_018718643.1 PREDICTED: signal recognition particle 54 kDa pro... 96 1e-22 XP_002322968.2 Signal recognition particle 54 kDa protein 1 [Pop... 101 2e-22 OMP01402.1 hypothetical protein COLO4_11914 [Corchorus olitorius] 101 2e-22 OMO54398.1 hypothetical protein CCACVL1_27833 [Corchorus capsula... 101 2e-22 GAV75447.1 SRP54 domain-containing protein/SRP54_N domain-contai... 101 2e-22 XP_019164793.1 PREDICTED: signal recognition particle 54 kDa pro... 101 2e-22 KZV56039.1 signal recognition particle 54 kD protein [Dorcoceras... 101 2e-22 XP_002299799.2 Signal recognition particle 54 kDa protein 1 [Pop... 101 2e-22 XP_006373975.1 hypothetical protein POPTR_0016s12030g [Populus t... 101 2e-22 ABK95819.1 unknown [Populus trichocarpa] 101 2e-22 XP_015870483.1 PREDICTED: signal recognition particle 54 kDa pro... 100 3e-22 KVH98037.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 100 5e-22 XP_010279659.1 PREDICTED: signal recognition particle 54 kDa pro... 100 5e-22 XP_010259930.1 PREDICTED: signal recognition particle 54 kDa pro... 100 5e-22 >XP_010097202.1 hypothetical protein L484_025749 [Morus notabilis] EXB67269.1 hypothetical protein L484_025749 [Morus notabilis] Length = 80 Score = 100 bits (249), Expect = 3e-25 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG 260 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG Sbjct: 31 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG 78 >XP_016477211.1 PREDICTED: signal recognition particle 54 kDa protein 1-like [Nicotiana tabacum] Length = 143 Score = 97.8 bits (242), Expect = 2e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQ+MSKVLPPQMLKQIGGMGGLQ+LMKQMGSAKDMMGMFGGGE Sbjct: 95 LSRNMNAQNMSKVLPPQMLKQIGGMGGLQSLMKQMGSAKDMMGMFGGGE 143 >XP_017978974.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Theobroma cacao] EOY25893.1 Signal recognition particle, SRP54 subunit protein [Theobroma cacao] Length = 494 Score = 102 bits (254), Expect = 7e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >XP_011073411.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Sesamum indicum] Length = 495 Score = 102 bits (254), Expect = 7e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >XP_002517663.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ricinus communis] EEF44827.1 signal recognition particle 54 kD protein, putative [Ricinus communis] Length = 497 Score = 102 bits (254), Expect = 7e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 494 >KCW54894.1 hypothetical protein EUGRSUZ_I00867 [Eucalyptus grandis] Length = 150 Score = 95.9 bits (237), Expect = 1e-22 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 400 SRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 SRNMNAQHMS+VLPPQMLKQI GMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 102 SRNMNAQHMSRVLPPQMLKQISGMGGLQNLMKQMGSGKDMMGMFGGGE 149 >XP_018718643.1 PREDICTED: signal recognition particle 54 kDa protein 3-like isoform X2 [Eucalyptus grandis] Length = 154 Score = 95.9 bits (237), Expect = 1e-22 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 400 SRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 SRNMNAQHMS+VLPPQMLKQI GMGGLQNLMKQMGS KDMMGMFGGGE Sbjct: 106 SRNMNAQHMSRVLPPQMLKQISGMGGLQNLMKQMGSGKDMMGMFGGGE 153 >XP_002322968.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] EEF04729.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] Length = 493 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 444 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 492 >OMP01402.1 hypothetical protein COLO4_11914 [Corchorus olitorius] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >OMO54398.1 hypothetical protein CCACVL1_27833 [Corchorus capsularis] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >GAV75447.1 SRP54 domain-containing protein/SRP54_N domain-containing protein/SRP_SPB domain-containing protein [Cephalotus follicularis] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >XP_019164793.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ipomoea nil] XP_019164794.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ipomoea nil] XP_019164795.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ipomoea nil] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >KZV56039.1 signal recognition particle 54 kD protein [Dorcoceras hygrometricum] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >XP_002299799.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] EEE84604.2 Signal recognition particle 54 kDa protein 1 [Populus trichocarpa] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >XP_006373975.1 hypothetical protein POPTR_0016s12030g [Populus trichocarpa] XP_011047423.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Populus euphratica] ERP51772.1 hypothetical protein POPTR_0016s12030g [Populus trichocarpa] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >ABK95819.1 unknown [Populus trichocarpa] Length = 495 Score = 101 bits (251), Expect = 2e-22 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGD 494 >XP_015870483.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Ziziphus jujuba] Length = 496 Score = 100 bits (249), Expect = 3e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG 260 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGG 493 >KVH98037.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 495 Score = 100 bits (248), Expect = 5e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494 >XP_010279659.1 PREDICTED: signal recognition particle 54 kDa protein 2 [Nelumbo nucifera] Length = 495 Score = 100 bits (248), Expect = 5e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494 >XP_010259930.1 PREDICTED: signal recognition particle 54 kDa protein 2-like [Nelumbo nucifera] Length = 495 Score = 100 bits (248), Expect = 5e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 403 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSAKDMMGMFGGGE 257 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGS+KDMMGMFGGG+ Sbjct: 446 LSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQMGSSKDMMGMFGGGD 494