BLASTX nr result
ID: Glycyrrhiza35_contig00008368
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00008368 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007141973.1 hypothetical protein PHAVU_008G241600g [Phaseolus... 108 2e-28 KOM47100.1 hypothetical protein LR48_Vigan07g080400 [Vigna angul... 107 6e-28 XP_003616146.2 hypothetical protein MTR_5g076600 [Medicago trunc... 104 6e-27 KDP35707.1 hypothetical protein JCGZ_10479 [Jatropha curcas] 95 6e-23 EER97156.2 hypothetical protein SORBI_002G292400 [Sorghum bicolor] 91 2e-21 ONM23402.1 hypothetical protein ZEAMMB73_Zm00001d006316 [Zea mays] 89 8e-21 OEL14519.1 hypothetical protein BAE44_0024461 [Dichanthelium oli... 90 1e-20 KQL25645.1 hypothetical protein SETIT_031804mg [Setaria italica] 87 4e-20 BAT09346.1 Os09g0555450 [Oryza sativa Japonica Group] 85 1e-18 EPS67586.1 hypothetical protein M569_07192, partial [Genlisea au... 82 7e-18 KVI03033.1 hypothetical protein Ccrd_018672 [Cynara cardunculus ... 80 4e-17 KZN10744.1 hypothetical protein DCAR_003400 [Daucus carota subsp... 78 2e-16 KQJ91407.1 hypothetical protein BRADI_4g37510 [Brachypodium dist... 77 7e-16 EMT14912.1 hypothetical protein F775_27789 [Aegilops tauschii] 76 9e-16 BAK05462.1 predicted protein [Hordeum vulgare subsp. vulgare] 74 7e-15 KQJ96609.1 hypothetical protein BRADI_3g25640 [Brachypodium dist... 72 4e-14 KQK19186.1 hypothetical protein BRADI_1g46831 [Brachypodium dist... 72 6e-14 XP_010227917.1 PREDICTED: uncharacterized protein LOC100843543 [... 72 1e-13 >XP_007141973.1 hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] ESW13967.1 hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 108 bits (270), Expect = 2e-28 Identities = 53/57 (92%), Positives = 53/57 (92%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRS 356 IFGKHVFP QIILFASGLLF ASTTYDVHRSIKNNQTPPSQEQLKALQDYI S RRS Sbjct: 3 IFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARRS 59 >KOM47100.1 hypothetical protein LR48_Vigan07g080400 [Vigna angularis] Length = 60 Score = 107 bits (267), Expect = 6e-28 Identities = 52/57 (91%), Positives = 53/57 (92%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRS 356 IFGKHVFP QIILFASGLLF ASTTYDVHRSIKNNQTPPSQEQ+KALQDYI S RRS Sbjct: 3 IFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQVKALQDYIESARRS 59 >XP_003616146.2 hypothetical protein MTR_5g076600 [Medicago truncatula] AES99104.2 hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 60 Score = 104 bits (260), Expect = 6e-27 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRSP 359 IFGK VFP QIILFASGLLFLASTTYDVHRSIKNN+TPPS+EQLKAL++YI SVRRSP Sbjct: 3 IFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRSP 60 >KDP35707.1 hypothetical protein JCGZ_10479 [Jatropha curcas] Length = 60 Score = 94.7 bits (234), Expect = 6e-23 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRSP 359 IFGK+V PGQI+L ASG++FLASTTYDVHRSIKNN+TPPS+EQ++AL+DYI S R SP Sbjct: 3 IFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRASP 60 >EER97156.2 hypothetical protein SORBI_002G292400 [Sorghum bicolor] Length = 58 Score = 90.5 bits (223), Expect = 2e-21 Identities = 39/56 (69%), Positives = 51/56 (91%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 +FGKHVFP QI+LFA+GL+F +TTYDVHRSIKNN+ PP++EQ++ALQDYINS ++ Sbjct: 3 LFGKHVFPRQIVLFAAGLVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKKQ 58 >ONM23402.1 hypothetical protein ZEAMMB73_Zm00001d006316 [Zea mays] Length = 64 Score = 89.4 bits (220), Expect = 8e-21 Identities = 38/53 (71%), Positives = 49/53 (92%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINS 344 +FGKHVFP QI+LFA+G++F +TTYDVHRSIKNN+ PP++EQ++ALQDYINS Sbjct: 3 LFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 55 >OEL14519.1 hypothetical protein BAE44_0024461 [Dichanthelium oligosanthes] Length = 91 Score = 89.7 bits (221), Expect = 1e-20 Identities = 39/56 (69%), Positives = 50/56 (89%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 +FGKHVFP QI LFA+GLLF +TTYDVHRSIKNN+ PP++EQ++ALQDY+NS ++ Sbjct: 36 LFGKHVFPRQIALFAAGLLFFGATTYDVHRSIKNNEQPPTREQMEALQDYVNSKKQ 91 >KQL25645.1 hypothetical protein SETIT_031804mg [Setaria italica] Length = 58 Score = 87.4 bits (215), Expect = 4e-20 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 +FGKHVFP QI L ASG+LF +TTYDVHRSIKNN+ PP++EQ++ALQDYINS ++ Sbjct: 3 LFGKHVFPRQIALVASGVLFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKKQ 58 >BAT09346.1 Os09g0555450 [Oryza sativa Japonica Group] Length = 113 Score = 85.1 bits (209), Expect = 1e-18 Identities = 36/57 (63%), Positives = 50/57 (87%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRS 356 + GKHVFP Q+ L A+G++FL +TTYDVHRSIKNN+ PP++EQ++ALQDYINS +++ Sbjct: 57 VLGKHVFPRQVALLAAGVVFLGATTYDVHRSIKNNEQPPTKEQMEALQDYINSKKQN 113 >EPS67586.1 hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 81.6 bits (200), Expect = 7e-18 Identities = 37/56 (66%), Positives = 48/56 (85%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 IFGK + QI +F++G+LF A+TTYDVHRSIKNN+ PPS EQ++AL+DYI+SVRR Sbjct: 3 IFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >KVI03033.1 hypothetical protein Ccrd_018672 [Cynara cardunculus var. scolymus] Length = 60 Score = 79.7 bits (195), Expect = 4e-17 Identities = 34/54 (62%), Positives = 47/54 (87%) Frame = +3 Query: 192 GKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 GK + P QIILFA+G+L + ST+YD+HRSIKNN+TPPS+EQ++A++DY+ S RR Sbjct: 5 GKQIHPRQIILFAAGMLVIGSTSYDIHRSIKNNETPPSKEQIQAMEDYLASKRR 58 >KZN10744.1 hypothetical protein DCAR_003400 [Daucus carota subsp. sativus] Length = 61 Score = 78.2 bits (191), Expect = 2e-16 Identities = 37/56 (66%), Positives = 48/56 (85%), Gaps = 1/56 (1%) Frame = +3 Query: 186 IFGKHVFPGQ-IILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVR 350 IFGK +FPG+ IIL ASG+L LA+TTYD+HRSIKNN TPP+Q++++ L DYI S+R Sbjct: 3 IFGKLMFPGRFIILSASGMLVLAATTYDIHRSIKNNSTPPTQQEMQELNDYIKSLR 58 >KQJ91407.1 hypothetical protein BRADI_4g37510 [Brachypodium distachyon] Length = 58 Score = 76.6 bits (187), Expect = 7e-16 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 + GKHV Q+ LFA+GL+F +TTYDVHRSIKNN PP++EQ++ALQ YI+S +R Sbjct: 3 LLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKKR 58 >EMT14912.1 hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 76.3 bits (186), Expect = 9e-16 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 + G+HV P QI L A+GL+F +TTYDVHRSIKNN PP++EQ+ ALQD+I+S +R Sbjct: 3 VLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >BAK05462.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 73.9 bits (180), Expect = 7e-15 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = +3 Query: 186 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 + G+HV P QI+L A+GL+F +TTYDVHRSIKNN PP+ EQ+ ALQ +I+S +R Sbjct: 3 LLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >KQJ96609.1 hypothetical protein BRADI_3g25640 [Brachypodium distachyon] Length = 58 Score = 72.0 bits (175), Expect = 4e-14 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = +3 Query: 195 KHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 353 KHV P Q+ LFA+GL+ TTYDVHRSIKNN P ++EQ++ALQ+YI+S +R Sbjct: 6 KHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKKR 58 >KQK19186.1 hypothetical protein BRADI_1g46831 [Brachypodium distachyon] Length = 83 Score = 72.4 bits (176), Expect = 6e-14 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +3 Query: 192 GKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDY 335 GKHV P Q+ LFA+GL+F +TTYDVHRSIKNN PP++EQ++ALQ Y Sbjct: 5 GKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52 >XP_010227917.1 PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 119 Score = 72.4 bits (176), Expect = 1e-13 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +3 Query: 192 GKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDY 335 GKHV P Q+ LFA+GL+F +TTYDVHRSIKNN PP++EQ++ALQ Y Sbjct: 5 GKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52