BLASTX nr result
ID: Glycyrrhiza35_contig00007555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00007555 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007211208.1 hypothetical protein PRUPE_ppa011266mg [Prunus pe... 55 9e-07 AFK44214.1 unknown [Lotus japonicus] 52 7e-06 >XP_007211208.1 hypothetical protein PRUPE_ppa011266mg [Prunus persica] XP_008238239.1 PREDICTED: uncharacterized protein LOC103336886 [Prunus mume] ONI06015.1 hypothetical protein PRUPE_5G034300 [Prunus persica] Length = 216 Score = 54.7 bits (130), Expect = 9e-07 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 15/64 (23%) Frame = -3 Query: 310 EVCERSLLDSFRFCSLGCKVISPSLLPPSLKH------FEEEENLSKINNG--------- 176 EVCERSLLDSFRFCSLGCK++ S P +KH + E++ S ++G Sbjct: 121 EVCERSLLDSFRFCSLGCKIVGTSNNPQKMKHSKAMGSSDSEDSYSSSSHGRSKSSNKVQ 180 Query: 175 SFTP 164 SFTP Sbjct: 181 SFTP 184 >AFK44214.1 unknown [Lotus japonicus] Length = 215 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 310 EVCERSLLDSFRFCSLGCKVISPSLLPPSLKHFEEEENLS 191 EVCERSLLDSFRFCSLGCK++ S K+FE+++ LS Sbjct: 112 EVCERSLLDSFRFCSLGCKIVGTS------KNFEKKKKLS 145