BLASTX nr result
ID: Glycyrrhiza35_contig00006952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00006952 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KAE34487.1 hypothetical protein W610_02615, partial [Staphylococ... 61 8e-11 EUT77524.1 hypothetical protein O310_02010, partial [Staphylococ... 61 8e-11 EZY42791.1 hypothetical protein V052_02628, partial [Staphylococ... 61 9e-11 EVX72783.1 hypothetical protein U283_02705, partial [Staphylococ... 54 4e-08 EEY11248.1 hypothetical protein COI_0097 [Mannheimia haemolytica... 50 6e-07 >KAE34487.1 hypothetical protein W610_02615, partial [Staphylococcus aureus VET0363R] KAE36074.1 hypothetical protein W610_02168, partial [Staphylococcus aureus VET0363R] KAE39600.1 hypothetical protein W610_00790, partial [Staphylococcus aureus VET0363R] Length = 69 Score = 60.8 bits (146), Expect = 8e-11 Identities = 31/62 (50%), Positives = 36/62 (58%) Frame = +3 Query: 3 FPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSPSSALPRTV 182 FPL+ G LA G GCFP G HP S+ L+GIRSL FG G P P+SALP + Sbjct: 8 FPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRPNSALPPII 67 Query: 183 FT 188 T Sbjct: 68 IT 69 >EUT77524.1 hypothetical protein O310_02010, partial [Staphylococcus aureus M0125] EVA80172.1 hypothetical protein O597_00904, partial [Staphylococcus aureus M0549] Length = 70 Score = 60.8 bits (146), Expect = 8e-11 Identities = 31/62 (50%), Positives = 36/62 (58%) Frame = +3 Query: 3 FPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSPSSALPRTV 182 FPL+ G LA G GCFP G HP S+ L+GIRSL FG G P P+SALP + Sbjct: 9 FPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRPNSALPPII 68 Query: 183 FT 188 T Sbjct: 69 IT 70 >EZY42791.1 hypothetical protein V052_02628, partial [Staphylococcus aureus MSSA-93] EZY42792.1 hypothetical protein V052_02627, partial [Staphylococcus aureus MSSA-93] Length = 74 Score = 60.8 bits (146), Expect = 9e-11 Identities = 31/62 (50%), Positives = 36/62 (58%) Frame = +3 Query: 3 FPLSHELGALAVGQGCFPLHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSPSSALPRTV 182 FPL+ G LA G GCFP G HP S+ L+GIRSL FG G P P+SALP + Sbjct: 13 FPLNIYFGTLAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRPNSALPPII 72 Query: 183 FT 188 T Sbjct: 73 IT 74 >EVX72783.1 hypothetical protein U283_02705, partial [Staphylococcus aureus F68118] Length = 54 Score = 53.5 bits (127), Expect = 4e-08 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +3 Query: 30 LAVGQGCFPLHDGR*HPPCVSRAVLVGIRSLVRFGTAVGGPSPSSALPRTVFT 188 LA G GCFP G HP S+ L+GIRSL FG G P P+SALP + T Sbjct: 2 LAGGLGCFPFEHGPYHPCSDSQVKLIGIRSLSEFGNPRGAPRPNSALPPIIIT 54 >EEY11248.1 hypothetical protein COI_0097 [Mannheimia haemolytica serotype A2 str. OVINE] EEY13892.1 hypothetical protein COK_0004 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 47 Score = 50.4 bits (119), Expect = 6e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +1 Query: 67 DVSTRRVSPEQYSWVFGVWLGLVPLWAALAHPVLYPARYSLEALPK 204 DVST RVSPE +S VF V +GLV LA VLYP R L+ALPK Sbjct: 2 DVSTHRVSPEYHSSVFAVCIGLVIRDGPLAETVLYPRRCPLKALPK 47