BLASTX nr result
ID: Glycyrrhiza35_contig00006281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00006281 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP36104.1 Peptide methionine sulfoxide reductase msrB [Cajanus ... 52 5e-06 KYP36103.1 Peptide methionine sulfoxide reductase msrB [Cajanus ... 52 5e-06 XP_004513790.1 PREDICTED: peptide methionine sulfoxide reductase... 52 5e-06 >KYP36104.1 Peptide methionine sulfoxide reductase msrB [Cajanus cajan] Length = 192 Score = 51.6 bits (122), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 199 MASHSLSLPAARIPSSNRLIQKLDCKVLLLWPSRSQTKPSR 77 MAS SLSLP A IPSS RLIQK + +LLWPSR+ T P+R Sbjct: 1 MASRSLSLPTAHIPSS-RLIQKFENSKVLLWPSRAHTNPTR 40 >KYP36103.1 Peptide methionine sulfoxide reductase msrB [Cajanus cajan] Length = 201 Score = 51.6 bits (122), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 199 MASHSLSLPAARIPSSNRLIQKLDCKVLLLWPSRSQTKPSR 77 MAS SLSLP A IPSS RLIQK + +LLWPSR+ T P+R Sbjct: 1 MASRSLSLPTAHIPSS-RLIQKFENSKVLLWPSRAHTNPTR 40 >XP_004513790.1 PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic [Cicer arietinum] Length = 206 Score = 51.6 bits (122), Expect = 5e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 5/48 (10%) Frame = -2 Query: 199 MASHSLSL--PAARIPSSNRLIQKLDC---KVLLLWPSRSQTKPSRRV 71 M SH LSL PAA+IPS NRLIQKLDC LLWPSR+ KP++R+ Sbjct: 1 MGSHILSLSQPAAQIPS-NRLIQKLDCVFHSKFLLWPSRAHFKPTKRI 47