BLASTX nr result
ID: Glycyrrhiza35_contig00006267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00006267 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007154507.1 hypothetical protein PHAVU_003G124400g [Phaseolus... 59 9e-10 GAU16755.1 hypothetical protein TSUD_199980 [Trifolium subterran... 59 1e-09 XP_003609905.1 hypothetical protein MTR_4g124250 [Medicago trunc... 59 1e-09 XP_004508069.1 PREDICTED: uncharacterized protein LOC101505378 [... 58 2e-09 XP_019463382.1 PREDICTED: uncharacterized protein LOC109362200 [... 57 4e-09 AFK48440.1 unknown [Lotus japonicus] 57 4e-09 XP_003551004.1 PREDICTED: uncharacterized protein LOC100787873 [... 57 4e-09 AFK44847.1 unknown [Lotus japonicus] 57 5e-09 XP_016193446.1 PREDICTED: uncharacterized protein LOC107634487 [... 57 6e-09 XP_015955085.1 PREDICTED: uncharacterized protein LOC107479467 [... 57 6e-09 XP_019455647.1 PREDICTED: uncharacterized protein LOC109356647 i... 56 1e-08 XP_019455623.1 PREDICTED: uncharacterized protein LOC109356647 i... 56 1e-08 XP_002314339.1 hypothetical protein POPTR_0010s00660g [Populus t... 56 1e-08 KYP57764.1 hypothetical protein KK1_004041 [Cajanus cajan] 55 2e-08 XP_003542398.1 PREDICTED: uncharacterized protein LOC100305862 [... 55 2e-08 XP_014508039.1 PREDICTED: uncharacterized protein LOC106767624 [... 55 3e-08 OAY21330.1 hypothetical protein MANES_S096900 [Manihot esculenta] 55 4e-08 AFK34951.1 unknown [Lotus japonicus] 54 4e-08 XP_012828108.1 PREDICTED: uncharacterized protein LOC105949355 [... 55 4e-08 KYP54449.1 hypothetical protein KK1_000637 [Cajanus cajan] 55 4e-08 >XP_007154507.1 hypothetical protein PHAVU_003G124400g [Phaseolus vulgaris] ESW26501.1 hypothetical protein PHAVU_003G124400g [Phaseolus vulgaris] Length = 74 Score = 58.9 bits (141), Expect = 9e-10 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + RRVMDLQGEVMACGYEDVQVMWSILD+ Sbjct: 34 QERRVMDLQGEVMACGYEDVQVMWSILDK 62 >GAU16755.1 hypothetical protein TSUD_199980 [Trifolium subterraneum] Length = 76 Score = 58.5 bits (140), Expect = 1e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + RR+MDLQGEVMACGYEDVQVMWS+LDR Sbjct: 34 QERRIMDLQGEVMACGYEDVQVMWSMLDR 62 >XP_003609905.1 hypothetical protein MTR_4g124250 [Medicago truncatula] AES92102.1 hypothetical protein MTR_4g124250 [Medicago truncatula] Length = 77 Score = 58.5 bits (140), Expect = 1e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + RR+MDLQGEVMACGYEDVQVMWS+LDR Sbjct: 35 QERRIMDLQGEVMACGYEDVQVMWSMLDR 63 >XP_004508069.1 PREDICTED: uncharacterized protein LOC101505378 [Cicer arietinum] Length = 76 Score = 58.2 bits (139), Expect = 2e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + RRVMDL GEVMACGYEDVQVMWSILDR Sbjct: 34 QERRVMDLHGEVMACGYEDVQVMWSILDR 62 >XP_019463382.1 PREDICTED: uncharacterized protein LOC109362200 [Lupinus angustifolius] XP_019463383.1 PREDICTED: uncharacterized protein LOC109362200 [Lupinus angustifolius] OIW00190.1 hypothetical protein TanjilG_29180 [Lupinus angustifolius] Length = 74 Score = 57.4 bits (137), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 252 EAEAEARRVMDLQGEVMACGYEDVQVMWSILDR 154 +AE E +RVMDLQGEVMACGYEDVQVMWS+LD+ Sbjct: 33 QAEQE-KRVMDLQGEVMACGYEDVQVMWSMLDK 64 >AFK48440.1 unknown [Lotus japonicus] Length = 75 Score = 57.4 bits (137), Expect = 4e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + R VMDLQGEVMACGYEDVQVMWSILDR Sbjct: 35 QERGVMDLQGEVMACGYEDVQVMWSILDR 63 >XP_003551004.1 PREDICTED: uncharacterized protein LOC100787873 [Glycine max] KHN17787.1 hypothetical protein glysoja_005984 [Glycine soja] KRH02506.1 hypothetical protein GLYMA_17G042600 [Glycine max] Length = 75 Score = 57.4 bits (137), Expect = 4e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + R+VMDLQGEVMACGYEDVQVMWSILD+ Sbjct: 35 QERQVMDLQGEVMACGYEDVQVMWSILDK 63 >AFK44847.1 unknown [Lotus japonicus] Length = 73 Score = 57.0 bits (136), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 246 EAEARRVMDLQGEVMACGYEDVQVMWSILDR 154 + + R+MDLQGEVMACGYEDVQVMWSILD+ Sbjct: 32 QEQENRIMDLQGEVMACGYEDVQVMWSILDK 62 >XP_016193446.1 PREDICTED: uncharacterized protein LOC107634487 [Arachis ipaensis] Length = 77 Score = 57.0 bits (136), Expect = 6e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 252 EAEAEARRVMDLQGEVMACGYEDVQVMWSILDR 154 + E E R VMDL GEVMACGYEDVQVMWSILD+ Sbjct: 34 QTEQENRVVMDLHGEVMACGYEDVQVMWSILDK 66 >XP_015955085.1 PREDICTED: uncharacterized protein LOC107479467 [Arachis duranensis] Length = 77 Score = 57.0 bits (136), Expect = 6e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 252 EAEAEARRVMDLQGEVMACGYEDVQVMWSILDR 154 + E E R VMDL GEVMACGYEDVQVMWSILD+ Sbjct: 34 QTEQENRVVMDLHGEVMACGYEDVQVMWSILDK 66 >XP_019455647.1 PREDICTED: uncharacterized protein LOC109356647 isoform X2 [Lupinus angustifolius] Length = 73 Score = 56.2 bits (134), Expect = 1e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + +RVMDLQGEVMACGYED+QVMWS+LD+ Sbjct: 35 QEKRVMDLQGEVMACGYEDIQVMWSMLDK 63 >XP_019455623.1 PREDICTED: uncharacterized protein LOC109356647 isoform X1 [Lupinus angustifolius] XP_019455633.1 PREDICTED: uncharacterized protein LOC109356647 isoform X1 [Lupinus angustifolius] OIW18788.1 hypothetical protein TanjilG_13540 [Lupinus angustifolius] Length = 74 Score = 56.2 bits (134), Expect = 1e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + +RVMDLQGEVMACGYED+QVMWS+LD+ Sbjct: 35 QEKRVMDLQGEVMACGYEDIQVMWSMLDK 63 >XP_002314339.1 hypothetical protein POPTR_0010s00660g [Populus trichocarpa] ABK96144.1 unknown [Populus trichocarpa] EEF00510.1 hypothetical protein POPTR_0010s00660g [Populus trichocarpa] Length = 74 Score = 55.8 bits (133), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 E +RV+DL GEVMACGYEDVQVMWSILD+ Sbjct: 35 EEKRVLDLHGEVMACGYEDVQVMWSILDK 63 >KYP57764.1 hypothetical protein KK1_004041 [Cajanus cajan] Length = 75 Score = 55.5 bits (132), Expect = 2e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + R+VMDL GEVMACGYEDVQVMWSILD+ Sbjct: 35 QERQVMDLHGEVMACGYEDVQVMWSILDK 63 >XP_003542398.1 PREDICTED: uncharacterized protein LOC100305862 [Glycine max] ACU13751.1 unknown [Glycine max] KHN45019.1 hypothetical protein glysoja_023591 [Glycine soja] KRH19446.1 hypothetical protein GLYMA_13G117300 [Glycine max] Length = 76 Score = 55.5 bits (132), Expect = 2e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + R+VMDL GEVMACGYEDVQVMWSILD+ Sbjct: 36 QERQVMDLHGEVMACGYEDVQVMWSILDK 64 >XP_014508039.1 PREDICTED: uncharacterized protein LOC106767624 [Vigna radiata var. radiata] Length = 71 Score = 55.1 bits (131), Expect = 3e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + RVMDL GEVMACGYEDVQVMWSILD+ Sbjct: 34 QENRVMDLHGEVMACGYEDVQVMWSILDK 62 >OAY21330.1 hypothetical protein MANES_S096900 [Manihot esculenta] Length = 71 Score = 54.7 bits (130), Expect = 4e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 231 RVMDLQGEVMACGYEDVQVMWSILDR 154 RVMDL GEVMACGYEDVQVMWSILD+ Sbjct: 35 RVMDLHGEVMACGYEDVQVMWSILDK 60 >AFK34951.1 unknown [Lotus japonicus] Length = 57 Score = 54.3 bits (129), Expect = 4e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 225 MDLQGEVMACGYEDVQVMWSILDR 154 MDLQGEVMACGYEDVQVMWSILDR Sbjct: 1 MDLQGEVMACGYEDVQVMWSILDR 24 >XP_012828108.1 PREDICTED: uncharacterized protein LOC105949355 [Erythranthe guttata] Length = 72 Score = 54.7 bits (130), Expect = 4e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 252 EAEAEARRVMDLQGEVMACGYEDVQVMWSILDR 154 + E + R+M LQGEVMACGYEDVQVMWSILD+ Sbjct: 31 QQEEQEDRIMALQGEVMACGYEDVQVMWSILDK 63 >KYP54449.1 hypothetical protein KK1_000637 [Cajanus cajan] Length = 73 Score = 54.7 bits (130), Expect = 4e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 240 EARRVMDLQGEVMACGYEDVQVMWSILDR 154 + R+MDL GEVMACGYEDVQVMWSILD+ Sbjct: 34 QENRIMDLHGEVMACGYEDVQVMWSILDK 62